KEGG   Homo sapiens (human): 58495
Entry
58495             CDS       T01001                                 

Gene name
OVOL2, CHED, CHED1, CHED2, EUROIMAGE566589, PPCD1, ZNF339
Definition
(RefSeq) ovo like zinc finger 2
  KO
K09216  ovo
Organism
hsa  Homo sapiens (human)
Disease
H00961  Posterior polymorphous corneal dystrophy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    58495 (OVOL2)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    58495 (OVOL2)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_3rep zf-C2H2_6 zf-H2C2_5 zf-met zf_C2H2_ZHX zf-C2H2_jaz
Other DBs
NCBI-GeneID: 58495
NCBI-ProteinID: NP_067043
OMIM: 616441
HGNC: 15804
Ensembl: ENSG00000125850
Vega: OTTHUMG00000031960
Pharos: Q9BRP0(Tbio)
UniProt: Q9BRP0
Position
20p11.23
AA seq 275 aa
MPKVFLVKRRSLGVSVRSWDELPDEKRADTYIPVGLGRLLHDPPEDCRSDGGSSSGSGSS
SAGEPGGAESSSSPHAPESETPEPGDAEGPDGHLATKQRPVARSKIKFTTGTCSDSVVHS
CDLCGKGFRLQRMLNRHLKCHNQVKRHLCTFCGKGFNDTFDLKRHVRTHTGIRPYKCNVC
NKAFTQRCSLESHLKKIHGVQQQYAYKQRRDKLYVCEDCGYTGPTQEDLYLHVNSAHPGS
SFLKKTSKKLAALLQGKLTSAHQENTSLSEEEERK
NT seq 828 nt   +upstreamnt  +downstreamnt
atgcccaaagtcttcctggtgaagaggaggagcctgggggtctcggtccgcagctgggat
gagctcccggatgagaaaagggcagacacctacatcccagtgggcctaggccgcctgctc
cacgacccccccgaggactgccgcagcgacggcggcagcagcagcggcagcggcagcagc
agcgcgggggagcctggaggagcagagagcagctcgtccccgcacgcccccgagagcgaa
acccccgagcccggcgacgccgagggccccgatggacacctggcgaccaagcagcgcccg
gtcgccagatcgaaaatcaagttcaccacaggcacgtgcagcgactcggtggttcacagc
tgtgacctgtgtggcaagggcttccgtctgcagcgcatgctgaaccgtcacctcaagtgc
cacaaccaggtgaaaagacacctgtgcaccttctgcggcaagggcttcaacgacaccttc
gacctgaagaggcacgtccgcacacacacaggcattcgtccctacaaatgcaacgtctgc
aataaagccttcacccagcgctgctctctggagtcccacctgaagaaaatccatggggtg
cagcagcagtatgcctataagcagcggcgggacaagctctacgtctgcgaggattgcggc
tacacgggccccacccaggaggacctgtacctgcacgtgaacagtgcccatccgggcagc
tcgtttctcaaaaagacatctaaaaaactggcagcccttctgcagggcaagctgacatcc
gcacaccaggagaataccagcctgagtgaggaggaggagaggaagtga

DBGET integrated database retrieval system