KEGG   Homo sapiens (human): 58505
Entry
58505             CDS       T01001                                 
Symbol
OSTC, DC2
Name
(RefSeq) oligosaccharyltransferase complex non-catalytic subunit
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: OST3_OST6
Other DBs
NCBI-GeneID: 58505
NCBI-ProteinID: NP_067050
OMIM: 619023
HGNC: 24448
Ensembl: ENSG00000198856
Pharos: Q9NRP0(Tbio)
UniProt: Q9NRP0 A0A024RDJ1
Structure
Position
4:108650599..108667820
AA seq 149 aa
METLYRVPFLVLECPNLKLKKPPWLHMPSAMTVYALVVVSYFLITGGIIYDVIVEPPSVG
SMTDEHGHQRPVAFLAYRVNGQYIMEGLASSFLFTMGGLGFIILDRSNAPNIPKLNRFLL
LFIGFVCVLLSFFMARVFMRMKLPGYLMG
NT seq 450 nt   +upstreamnt  +downstreamnt
atggagactttgtaccgtgtcccgttcttagtgctcgaatgtcccaacctgaagctgaag
aagccgccctggttgcacatgccgtcggccatgactgtgtatgctctggtggtggtgtct
tacttcctcatcaccggaggaataatttatgatgttattgttgaacctccaagtgtcggt
tctatgactgatgaacatgggcatcagaggccagtagctttcttggcctacagagtaaat
ggacaatatattatggaaggacttgcatccagcttcctatttacaatgggaggtttaggt
ttcataatcctggaccgatcgaatgcaccaaatatcccaaaactcaatagattccttctt
ctgttcattggattcgtctgtgtcctattgagttttttcatggctagagtattcatgaga
atgaaactgccgggctatctgatgggttag

DBGET integrated database retrieval system