KEGG   Homo sapiens (human): 58510Help
Entry
58510             CDS       T01001                                 

Gene name
PRODH2, HSPOX1, HYPDH
Definition
(RefSeq) proline dehydrogenase 2
  KO
K11394  hydroxyproline dehydrogenase [EC:1.5.5.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00330  Arginine and proline metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    58510 (PRODH2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.3  hydroxyproline dehydrogenase
     58510 (PRODH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_dh
Motif
Other DBs
NCBI-GeneID: 58510
NCBI-ProteinID: NP_067055
OMIM: 616377
HGNC: 17325
Ensembl: ENSG00000250799
Vega: OTTHUMG00000180688
Pharos: Q9UF12(Tbio)
UniProt: Q9UF12
Position
19q13.12
AA seq 536 aa AA seqDB search
MSPRVVSNSSVLASQSVGITNVRTVFSNVFNNTTAFPILRGSNCHKITAPGLGKGQLVNL
LPPENLPWCGGSQGPRMLRTCYVLCSQAGPPSRGWQSLSFDGGAFHLKGTGELTRALLVL
RLCAWPPLVTHGLLLQAWSRRLLGSRLSGAFLRASVYGQFVAGETAEEVKGCVQQLRTLS
LRPLLAVPTEEEPDSAAKSGEAWYEGNLGAMLRCVDLSRGLLEPPSLAEASLMQLKVTAL
TSTRLCKELASWVRRPGASLELSPERLAEAMDSGQNLQVSCLNAEQNQHLRASLSRLHRV
AQYARAQHVRLLVDAEYTSLNPALSLLVAALAVRWNSPGEGGPWVWNTYQACLKDTFERL
GRDAEAAHRAGLAFGVKLVRGAYLDKERAVAQLHGMEDPTQPDYEATSQSYSRCLELMLT
HVARHGPMCHLMVASHNEESVRQATKRMWELGIPLDGTVCFGQLLGMCDHVSLALGQAGY
VVYKSIPYGSLEEVIPYLIRRAQENRSVLQGARREQELLSQELWRRLLPGCRRIPH
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcccagggtagtctcaaactcctcggtcttggcctcccaaagtgttgggattaca
aacgtgagaaccgtattttcaaatgtattcaataacactacagcgtttccaattttaaga
ggaagcaattgccacaaaatcactgcccctggtctgggcaaggggcagttggtgaacttg
ctgcctccagagaaccttccctggtgtggaggcagccagggacccaggatgctccggacc
tgttacgtgctctgttcccaagctggtcccccctccaggggctggcagtccctgagcttt
gatggcggggccttccaccttaagggcacaggagagctgacacgggccttgctggttctc
cggctgtgtgcctggcccccactcgtcactcacgggctgttgctccaggcctggtctcgg
cgactcctgggctcccggctctcaggcgcatttctccgagcatccgtctatgggcagttt
gtggctggtgagacagcagaggaggtgaagggctgcgtgcagcagctgcggaccctcagc
ctccgaccactgctggcagtgcccactgaggaggagccggactctgctgccaagagtggt
gaggcgtggtatgaggggaacctcggtgctatgctgcggtgtgtggacctgtcacggggc
ctcctggagccccccagcctggctgaggccagcctcatgcagctgaaggtgacggcgctg
accagtactcggctctgtaaggagctagcctcgtgggtcagaaggccaggagcctccttg
gagctgagccccgagaggctggctgaagctatggactctgggcagaacctccaggtctcc
tgcctcaatgctgagcagaaccagcacctccgggcctccctcagccgcctgcatcgggtg
gcacagtatgcccgggcccagcacgtgcggctcctggtggatgcggagtacacctcactg
aaccctgcgctctcgctgctggtggctgccctggctgtgcgctggaacagcccgggtgaa
ggcgggccctgggtgtggaacacctaccaggcctgtctaaaggacacattcgagcggctg
gggagggatgcagaggctgcgcacagggccggcctggccttcggagtgaagctggtacga
ggtgcatatctggacaaggagagagcggtggcccagctccatgggatggaagaccccact
cagcctgactatgaggccaccagtcagagttacagccgctgcctggaactgatgctgacg
cacgtggcccgccatggccccatgtgccacctcatggtggcttcccacaatgaggaatct
gttcgccaggcaaccaagcgcatgtgggagctgggcattcctctggatgggactgtctgt
ttcggacaacttctgggcatgtgtgaccacgtctctctagcactggggcaggccggctat
gtagtgtataagtccattccctatggctccttggaggaggtaatcccctacctgatccgg
agggcccaggagaaccggagcgtgcttcagggtgcccgcagggaacaggagctgctcagc
caagaactgtggcggcggctgctgccaggatgccgaaggataccccactag

DBGET integrated database retrieval system