KEGG   Homo sapiens (human): 58513
Entry
58513             CDS       T01001                                 

Gene name
EPS15L1, EPS15R
Definition
(RefSeq) epidermal growth factor receptor pathway substrate 15 like 1
  KO
K12472  epidermal growth factor receptor substrate 15
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    58513 (EPS15L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    58513 (EPS15L1)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    58513 (EPS15L1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    58513 (EPS15L1)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 EF-hand domain-containing proteins
  EH (EPS15 homology) domain-containing proteins
   58513 (EPS15L1)
SSDB
Motif
Pfam: EF-hand_4 EF-hand_1 EF-hand_6 EF-hand_7 Crescentin Spc7 EF-hand_8 EF-hand_9 ATG16 BicD IFT57 LMBR1 DUF745 EzrA EF-hand_5 MscS_porin Tropomyosin CALCOCO1 Fez1 DUF16 MPS2 DUF4201 WEMBL DUF4763 TPR_MLP1_2 MAD Prominin
Other DBs
NCBI-GeneID: 58513
NCBI-ProteinID: NP_067058
OMIM: 616826
HGNC: 24634
Ensembl: ENSG00000127527
Vega: OTTHUMG00000182361
Pharos: Q9UBC2(Tbio)
UniProt: Q9UBC2
Position
19p13.11
AA seq 864 aa
MAAPLIPLSQQIPTGNSLYESYYKQVDPAYTGRVGASEAALFLKKSGLSDIILGKIWDLA
DPEGKGFLDKQGFYVALRLVACAQSGHEVTLSNLNLSMPPPKFHDTSSPLMVTPPSAEAH
WAVRVEEKAKFDGIFESLLPINGLLSGDKVKPVLMNSKLPLDVLGRVWDLSDIDKDGHLD
RDEFAVAMHLVYRALEKEPVPSALPPSLIPPSKRKKTVFPGAVPVLPASPPPKDSLRSTP
SHGSVSSLNSTGSLSPKHSLKQTQPTVNWVVPVADKMRFDEIFLKTDLDLDGYVSGQEVK
EIFMHSGLTQNLLAHIWALADTRQTGKLSKDQFALAMYFIQQKVSKGIDPPQVLSPDMVP
PSERGTPGPDSSGSLGSGEFTGVKELDDISQEIAQLQREKYSLEQDIREKEEAIRQKTSE
VQELQNDLDRETSSLQELEAQKQDAQDRLDEMDQQKAKLRDMLSDVRQKCQDETQMISSL
KTQIQSQESDLKSQEDDLNRAKSELNRLQQEETQLEQSIQAGRVQLETIIKSLKSTQDEI
NQARSKLSQLHESRQEAHRSLEQYDQVLDGAHGASLTDLANLSEGVSLAERGSFGAMDDP
FKNKALLFSNNTQELHPDPFQTEDPFKSDPFKGADPFKGDPFQNDPFAEQQTTSTDPFGG
DPFKESDPFRGSATDDFFKKQTKNDPFTSDPFTKNPSLPSKLDPFESSDPFSSSSVSSKG
SDPFGTLDPFGSGSFNSAEGFADFSQMSKPPPSGPFTSSLGGAGFSDDPFKSKQDTPALP
PKKPAPPRPKPPSGKSTPVSQLGSADFPEAPDPFQPLGADSGDPFQSKKGFGDPFSGKDP
FVPSSAAKPSKASASGFADFTSVS
NT seq 2595 nt   +upstreamnt  +downstreamnt
atggcggcgccgctcatccccctctcccagcagattcccactggaaattcgttgtatgaa
tcttattacaagcaggtcgatccggcatacacagggagggtgggggcgagtgaagctgcg
ctttttctaaagaagtctggcctctcggacattatccttgggaagatatgggacttggcc
gatccagaaggtaaagggttcttggacaaacagggtttctatgttgcactgagactggtg
gcctgtgcacagagtggccatgaagttaccttgagcaatctgaatttgagcatgccaccg
cctaaatttcacgacaccagcagccctctgatggtcacaccgccctctgcagaggcccac
tgggctgtgagggtggaagaaaaggccaaatttgatgggatttttgaaagcctcttgccc
atcaatggtttgctctctggagacaaagtcaagccagtcctcatgaactcaaagctgcct
cttgatgtcctgggcagggtctgggacctcagtgacattgacaaggatgggcacttggat
cgagatgagttcgctgtggccatgcacttggtgtaccgagccctggagaaggagcccgtg
ccctccgccctgcccccgtccctcatcccaccctccaagagaaagaagactgtgttccct
ggcgccgtccccgtcctgcctgccagccccccaccaaaagacagcctccgctccacgccg
tcccacggcagcgtcagcagcctcaacagcacagggagcctgtcccccaagcacagcctc
aagcaaacacagccaacagtgaactgggtggtgcccgtggcagacaagatgcgatttgat
gagatattcctgaagaccgacctggacctggatggctacgtgagtggccaggaggtgaag
gagatcttcatgcactcgggcctcacccagaaccttctagcacacatatgggccctggcc
gatacgaggcaaacggggaagttaagcaaagaccaattcgcgttagctatgtatttcatt
cagcagaaggtcagtaaaggcatcgaccctcctcaagtcctctcgccggacatggtcccg
ccttcggagagaggcacgcccggcccggacagttcaggctctctcggctccggggagttt
actggcgtgaaggagcttgatgacatcagtcaagagattgcccagttacaaagagagaaa
tattcactggaacaagacattcgagaaaaggaagaggcaatcagacagaaaaccagcgag
gtgcaggaattacaaaatgacctagaccgggaaacaagcagtttgcaggagctcgaggct
cagaaacaggatgctcaagaccgcctggacgagatggaccagcagaaggccaagctccga
gacatgctgagcgacgtccggcagaagtgccaggatgagactcagatgatctcatcactg
aaaacgcaaatccaatctcaggaatctgacttaaagtcccaggaagacgatctgaaccga
gccaagtcggagctgaaccgattgcagcaggaggaaacccagctggagcagagcattcag
gctgggcgagtccagctggaaaccatcatcaagtccctgaagtcaacgcaagacgaaatc
aaccaggcaaggagcaaactttcccagctgcatgaaagccgccaggaggcccacaggagc
ctggagcagtatgaccaggtgctcgatggagcccatggtgccagcctgaccgacctggcc
aacctgagcgaaggcgtctccctggcagagaggggcagttttggagccatggatgatcct
ttcaaaaataaagccttgttatttagcaacaacacgcaagagttgcatccggatcctttc
cagacagaagaccccttcaaatctgacccatttaaaggagctgaccccttcaaaggcgac
ccgttccagaatgacccctttgcagaacagcagacaacttcaacagatccatttggaggg
gaccctttcaaagaaagtgacccattccgtggctctgccactgacgacttcttcaagaaa
cagacaaagaatgacccatttacctcggatccattcacgaaaaacccttccttaccttcg
aagctcgacccctttgaatccagtgatcccttttcatcctccagtgtctcctcaaaagga
tcagatccctttggaaccttagatcccttcggaagtgggtccttcaatagtgctgaaggc
tttgccgacttcagccagatgtccaagcccccaccttctggccctttcacctcctccttg
ggaggggcaggattctcagatgacccctttaaaagtaaacaggacactcctgctctgcct
ccgaagaaacctgctcctccacggcctaaaccgcccagcggtaaaagtacacctgtaagc
cagcttggttccgcagactttcccgaggcccccgatccattccagccactcggggctgac
agcggcgacccgttccaaagtaaaaaggggtttggggacccgtttagtggaaaagaccca
tttgtcccctcctctgcagctaaaccttctaaggcctctgcctcgggctttgcagacttc
acctctgtaagttga

DBGET integrated database retrieval system