KEGG   Homo sapiens (human): 58525
Entry
58525             CDS       T01001                                 

Gene name
WIZ, ZNF803
Definition
(RefSeq) WIZ zinc finger
Organism
hsa  Homo sapiens (human)
Motif
Pfam: zf-C2H2_4 zf-C2H2 zf-FCS
Other DBs
NCBI-GeneID: 58525
NCBI-ProteinID: NP_001317324
HGNC: 30917
Ensembl: ENSG00000011451
Vega: OTTHUMG00000182448
Pharos: O95785(Tbio)
UniProt: O95785
Position
19p13.12
AA seq 933 aa
MAASTAQCRVTKAESKAAAGPRAGGARERAPAGAPPPSPPSPGPAAPPAPPPPPPPPPPP
PPPPPPPPPPRDGPKAEPEPGPGPASAPAPGLGSEENAMVAMDLGSPSLPKKSLPVPGAL
EQVASRLSSKVAAEVPHGSKQELQDLKAQSLTTCEVCGACFETRKGLSSHARSHLRQLGV
AESESSGAPIDLLYELVKQKGLPDAHLGLPPGLAKKSSSLKEVVAGAPRPGLLSLAKPLD
APAVNKAIKSPPGFSAKGLGHPPSSPLLKKTPLALAGSPTPKNPEDKSPQLSLSPRPASP
KAQWPQSEDEGPLNLTSGPEPARDIRCEFCGEFFENRKGLSSHARSHLRQMGVTEWYVNG
SPIDTLREILKRRTQSRPGGPPNPPGPSPKALAKMMGGAGPGSSLEARSPSDLHISPLAK
KLPPPPGSPLGHSPTASPPPTARKMFPGLAAPSLPKKLKPEQIRVEIKREMLPGALHGEL
HPSEGPWGAPREDMTPLNLSSRAEPVRDIRCEFCGEFFENRKGLSSHARSHLRQMGVTEW
SVNGSPIDTLREILKKKSKPCLIKKEPPAGDLAPALAEDGPPTVAPGPVQSPLPLSPLAG
RPGKPGAGPAQVPRELSLTPITGAKPSATGYLGSVAAKRPLQEDRLLPAEVKAKTYIQTE
LPFKAKTLHEKTSHSSTEACCELCGLYFENRKALASHARAHLRQFGVTEWCVNGSPIETL
SEWIKHRPQKVGAYRSYIQGGRPFTKKFRSAGHGRDSDKRPSLGLAPGGLAVVGRSAGGE
PGPEAGRAADGGERPLAASPPGTVKAEEHQRQNINKFERRQARPPDASAARGGEDTNDLQ
QKLEEVRQPPPRVRPVPSLVPRPPQTSLVKFVGNIYTLKCRFCEVEFQGPLSIQEEWVRH
LQRHILEMNFSKADPPPEESQAPQAQTAAAEAP
NT seq 2802 nt   +upstreamnt  +downstreamnt
atggccgcctccaccgcccagtgccgagtgacaaaagcggagagcaaggcggcggcgggg
ccgcgcgcggggggcgcccgggagcgcgcgcccgcgggggcgcccccgcccagccccccg
agcccgggccccgcggcaccccccgcgccgccgccgccgcccccacccccgccgccgccg
ccaccaccaccgccaccgccaccgccgccgcgggacgggcccaaggccgagccggagccg
gggcccgggcccgcgtccgctcccgcgcccggcctgggttctgaggaaaacgcaatggtg
gccatggacttgggctctccctcgctccctaagaagagcctgcctgtccctggggccctg
gagcaggtggccagtcggctgagcagcaaagtggctgcagaggttcctcatggcagcaaa
caggagctgcaggacctcaaggcccagagcctgaccacctgcgaggtctgcggtgcctgc
tttgagacccgaaagggcctgtccagccacgcgcgctcccacctgcggcagctgggagtg
gcagagtcggaaagcagcggcgcacccatcgacctcctctacgagcttgtgaagcagaag
ggtctgcctgacgcccaccttgggctgcccccaggcctggctaagaagtccagctcactg
aaggaggtggtcgccggggccccccggcccggcttgctcagcctggccaagcccttggat
gcccctgctgtcaacaaagccatcaagtcgcctcccggcttctcggccaagggcctgggc
cacccgcccagctctccactcctcaaaaagacaccactggccctggcgggctcccctacc
cctaagaatcctgaggacaagagcccccagctgtccctgagcccccggccggcctcccca
aaggcacagtggcctcagtctgaggatgaggggcccttgaacctcacctcaggcccagag
ccagcacgagacatccgctgcgagttctgtggtgagttcttcgagaaccgcaagggcctc
tcgagccacgcgcgctcccatctgcggcaaatgggcgtgaccgagtggtacgtcaatggc
tcgcccatcgacacgctgcgggagatcctgaagagacggacccagtctcggcctggtgga
cctcccaacccaccagggccaagcccaaaagccctggccaagatgatgggcggcgcaggt
cctggcagctcactggaagcccgcagcccctcggaccttcacatctcacccttggccaag
aagttgccaccaccaccgggcagccccctgggccactcaccaactgcctctcctcctcct
acggcccgaaagatgttcccaggcctggctgcaccctccttgcccaagaagctgaagcct
gaacaaatacgggtggagatcaagcgggagatgctgccgggggcccttcatggggaactg
cacccatctgagggtccctggggggcaccacgggaagacatgacacccctgaacctgtcg
tcccgggcagagccggtgcgcgacatccgctgtgagttctgcggcgagttcttcgagaac
cgcaagggcctgtcgagtcacgcgcgctcacacctgcggcagatgggtgtgaccgagtgg
tccgtcaatggttcgcccatcgacacactgcgagagatcctcaagaagaagtccaagccg
tgcctcatcaagaaggagccaccggctggagacctggcccctgccctggctgaggacggg
cctcccaccgtggcccctgggcccgtgcagtccccactgccgctgtcgcccctggctggc
cggccaggcaaaccaggtgcagggccggcccaggttcctcgtgagctcagcctgacgccc
atcactggggccaagccctcagccactggctacctgggctcagtggcagccaagcggccc
ctgcaggaggaccgcctcctcccagcagaggtcaaggccaagacctacatccagactgaa
ctgcccttcaaggcaaagacccttcatgagaagacctcccactcctccaccgaggcctgc
tgcgagctgtgtggcctttactttgaaaaccgcaaggccctggccagccacgcacgggca
cacctgcggcagttcggcgtgaccgagtggtgcgtcaatggctcgcccatcgagacactg
agcgagtggatcaaacaccggccccagaaggtgggcgcctaccgcagctacatccagggc
ggccgccccttcaccaagaagttccgcagtgccggccatggccgtgacagtgacaagcgg
ccgtccctggggctggcacccgggggcctggccgtggtcggccgcagtgccggaggggag
ccagggcccgaggctggccgggcagccgacggtggtgagcggcctctggcagccagcccg
ccaggcaccgtgaaggctgaggagcaccagcggcagaacatcaacaaatttgaacgccga
caagcccgccctccagatgcctccgcagcccggggaggcgaggacaccaatgacctacag
cagaagctggaggaggtgcggcaacccccaccccgagtccggccagtcccctccctggtg
ccccggcccccccagacatcacttgtcaagttcgtgggcaacatctacaccctcaaatgc
aggttctgtgaggtggaattccagggccccctctccatccaggaagagtgggtgcggcac
ttacagcggcacatcctggagatgaacttctccaaagcggaccccccacctgaggagtcc
caggccccgcaggcacagacagcggcggcagaggctccctaa

DBGET integrated database retrieval system