KEGG   Homo sapiens (human): 58528Help
Entry
58528             CDS       T01001                                 

Gene name
RRAGD, RAGD, bA11D8.2.1
Definition
(RefSeq) Ras related GTP binding D
  KO
K16186  Ras-related GTP-binding protein C/D
Organism
hsa  Homo sapiens (human)
Pathway
hsa04140  Autophagy - animal
hsa04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    58528 (RRAGD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    58528 (RRAGD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gtr1_RagA Arf SRPRB Roc Ras MMR_HSR1 AAA_16
Motif
Other DBs
NCBI-GeneID: 58528
NCBI-ProteinID: NP_067067
OMIM: 608268
HGNC: 19903
Ensembl: ENSG00000025039
Vega: OTTHUMG00000015200
Pharos: Q9NQL2(Tbio)
UniProt: Q9NQL2
Structure
PDB: 

Position
6q15
AA seq 400 aa AA seqDB search
MSQVLGKPQPQDEDDAEEEEEEDELVGLADYGDGPDSSDADPDSGTEEGVLDFSDPFSTE
VKPRILLMGLRRSGKSSIQKVVFHKMSPNETLFLESTNKICREDVSNSSFVNFQIWDFPG
QIDFFDPTFDYEMIFRGTGALIFVIDSQDDYMEALARLHLTVTRAYKVNTDINFEVFIHK
VDGLSDDHKIETQRDIHQRANDDLADAGLEKIHLSFYLTSIYDHSIFEAFSKVVQKLIPQ
LPTLENLLNIFISNSGIEKAFLFDVVSKIYIATDSTPVDMQTYELCCDMIDVVIDISCIY
GLKEDGAGTPYDKESTAIIKLNNTTVLYLKEVTKFLALVCFVREESFERKGLIDYNFHCF
RKAIHEVFEVRMKVVKSRKVQNRLQKKKRATPNGTPRVLL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgagccaggtgctggggaagccgcagccgcaggacgaggacgacgcggaggaggaggag
gaggaggatgagctggtggggctagcggactacggagacgggcccgactcctccgacgcc
gatccggacagcggcacagaggagggagttctggacttcagtgaccccttcagcactgaa
gtgaagccgagaatcctgctcatgggcctgaggagaagcggcaagtcgtctattcagaaa
gttgtctttcacaaaatgtctcccaacgaaactctgttcttggagagcactaataagata
tgccgggaagatgtttccaacagctcctttgtcaattttcagatttgggacttcccagga
cagattgacttttttgaccctacatttgactatgagatgatcttccggggaacaggagca
ctgatatttgtcattgactcacaggatgattacatggaagccctggccaggctccacctc
acggtgaccagggcctacaaagtgaatactgacatcaacttcgaggtgtttattcataaa
gtggatggtctgtcagatgaccacaaaattgaaacccaaagagatattcaccagagggca
aacgatgaccttgcagatgctggattagaaaaaattcacctcagcttttatctgacaagc
atatatgatcattcaatatttgaagcttttagcaaagttgttcagaaactgattccacaa
ctcccaactctggagaatttgctgaacatctttatctcaaattctggaattgaaaaggca
tttctatttgatgtggtcagtaaaatttatattgcaactgatagtactccggtggatatg
caaacctatgagctctgctgtgatatgatagatgtggttattgacatctcttgtatttat
ggtctcaaagaagatggagcaggaaccccctatgacaaggaatccacagccatcataaag
cttaataatacaaccgtgctttatttaaaagaggtgacaaagttcctggctctcgtttgc
tttgtcagagaggaaagctttgaaagaaaagggctaattgactataattttcattgcttc
cggaaggccattcatgaagtttttgaggtgagaatgaaagtagtaaaatctcgaaaggtt
cagaatcggctgcagaagaaaaagagagccacccctaatgggacccctagagtgctgctg
tag

KEGG   Homo sapiens (human): 64121Help
Entry
64121             CDS       T01001                                 

Gene name
RRAGC, GTR2, RAGC, TIB929
Definition
(RefSeq) Ras related GTP binding C
  KO
K16186  Ras-related GTP-binding protein C/D
Organism
hsa  Homo sapiens (human)
Pathway
hsa04140  Autophagy - animal
hsa04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    64121 (RRAGC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    64121 (RRAGC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gtr1_RagA Arf Roc SRPRB Ras MMR_HSR1 AAA_16 AAA_14
Motif
Other DBs
NCBI-GeneID: 64121
NCBI-ProteinID: NP_071440
OMIM: 608267
HGNC: 19902
Ensembl: ENSG00000116954
Vega: OTTHUMG00000000490
Pharos: Q9HB90(Tbio)
UniProt: Q9HB90
Structure
PDB: 

Position
1p34.3
AA seq 399 aa AA seqDB search
MSLQYGAEETPLAGSYGAADSFPKDFGYGVEEEEEEAAAAGGGVGAGAGGGCGPGGADSS
KPRILLMGLRRSGKSSIQKVVFHKMSPNETLFLESTNKIYKDDISNSSFVNFQIWDFPGQ
MDFFDPTFDYEMIFRGTGALIYVIDAQDDYMEALTRLHITVSKAYKVNPDMNFEVFIHKV
DGLSDDHKIETQRDIHQRANDDLADAGLEKLHLSFYLTSIYDHSIFEAFSKVVQKLIPQL
PTLENLLNIFISNSGIEKAFLFDVVSKIYIATDSSPVDMQSYELCCDMIDVVIDVSCIYG
LKEDGSGSAYDKESMAIIKLNNTTVLYLKEVTKFLALVCILREESFERKGLIDYNFHCFR
KAIHEVFEVGVTSHRSCGHQTSASSLKALTHNGTPRNAI
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgcagtacggggcggaggagacgcccctcgccggcagttacggcgcggccgat
tcgtttccaaaggacttcggctacggcgtggaggaggaggaagaggaggcggcggcggcg
ggcggaggggttggggcaggggcaggcggtggctgtggtccggggggcgctgacagctcc
aagccgaggattctgctcatgggactccggcgcagcggcaagtcctccatccagaaggtg
gtgtttcataagatgtcacccaacgagaccctctttttggaaagtaccaacaagatttat
aaggatgacatttccaatagctcctttgtgaatttccagatatgggattttcctgggcaa
atggacttttttgacccaacctttgactatgagatgatcttcaggggaacaggagcattg
atatacgtcattgacgcacaggatgactacatggaggctttaacaagacttcacattact
gtttctaaagcctacaaagttaacccagacatgaattttgaggtttttattcacaaagtt
gatggtctgtctgatgatcacaaaatagaaacacagagggacattcatcaaagggccaat
gatgaccttgcagatgctgggctagaaaaactccatcttagcttttatctgactagtatc
tatgaccattcaatatttgaagcctttagtaaggtggtgcagaaactcattccacaactg
ccgaccttggaaaacctattaaatatctttatatcaaattcaggtattgaaaaagctttt
ctctttgatgttgtcagcaaaatctacattgcaacagacagttcccctgtggatatgcaa
tcttatgaactttgctgtgacatgatcgatgttgtaattgatgtgtcttgtatatatggg
ttaaaggaagatggaagtggaagtgcttatgacaaagaatctatggcaattatcaagctg
aataatacaactgtcctttatttaaaggaggtgactaaatttttggcactggtctgcatt
ctaagggaagaaagctttgaaagaaaaggtttaatagactacaacttccactgtttccga
aaagctattcatgaggtttttgaggtgggtgtgacttctcacaggagctgtggtcaccag
actagtgcctccagtctgaaagcgctgacacacaatggcacgccacgaaacgccatctag

DBGET integrated database retrieval system