KEGG   Homo sapiens (human): 5859
Entry
5859              CDS       T01001                                 

Symbol
QARS1, GLNRS, MSCCA, PRO2195, QARS
Name
(RefSeq) glutaminyl-tRNA synthetase 1
  KO
K01886  glutaminyl-tRNA synthetase [EC:6.1.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00970  Aminoacyl-tRNA biosynthesis
hsa01100  Metabolic pathways
Disease
H02132  Microcephaly syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    5859 (QARS1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hsa01007]
    5859 (QARS1)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hsa03016]
    5859 (QARS1)
Enzymes [BR:hsa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.18  glutamine---tRNA ligase
     5859 (QARS1)
Amino acid related enzymes [BR:hsa01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   5859 (QARS1)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    5859 (QARS1)
 Prokaryotic type
   Other AARSs
    5859 (QARS1)
SSDB
Motif
Pfam: tRNA-synt_1c tRNA_synt_1c_R1 tRNA-synt_1c_C tRNA_synt_1c_R2
Other DBs
NCBI-GeneID: 5859
NCBI-ProteinID: NP_005042
OMIM: 603727
HGNC: 9751
Ensembl: ENSG00000172053
Vega: OTTHUMG00000156774
Pharos: P47897(Tchem)
UniProt: P47897 B7Z840
Structure
PDB: 
4YE6 4YE9 4YE8 4R3Z

Position
3p21.31
AA seq 775 aa
MAALDSLSLFTSLGLSEQKARETLKNSALSAQLREAATQAQQTLGSTIDKATGILLYGLA
SRLRDTRRLSFLVSYIASKKIHTEPQLSAALEYVRSHPLDPIDTVDFERECGVGVIVTPE
QIEEAVEAAINRHRPQLLVERYHFNMGLLMGEARAVLKWADGKMIKNEVDMQVLHLLGPK
LEADLEKKFKVAKARLEETDRRTAKDVVENGETADQTLSLMEQLRGEALKFHKPGENYKT
PGYVVTPHTMNLLKQHLEITGGQVRTRFPPEPNGILHIGHAKAINFNFGYAKANNGICFL
RFDDTNPEKEEAKFFTAICDMVAWLGYTPYKVTYASDYFDQLYAWAVELIRRGLAYVCHQ
RGEELKGHNTLPSPWRDRPMEESLLLFEAMRKGKFSEGEATLRMKLVMEDGKMDPVAYRV
KYTPHHRTGDKWCIYPTYDYTHCLCDSIEHITHSLCTKEFQARRSSYFWLCNALDVYCPV
QWEYGRLNLHYAVVSKRKILQLVATGAVRDWDDPRLFTLTALRRRGFPPEAINNFCARVG
VTVAQTTMEPHLLEACVRDVLNDTAPRAMAVLESLRVIITNFPAAKSLDIQVPNFPADET
KGFHQVPFAPIVFIERTDFKEEPEPGFKRLAWGQPVGLRHTGYVIELQHVVKGPSGCVES
LEVTCRRADAGEKPKAFIHWVSQPLMCEVRLYERLFQHKNPEDPTEVPGGFLSDLNLASL
HVVDAALVDCSVALAKPFDKFQFERLGYFSVDPDSHQGKLVFNRTVTLKEDPGKV
NT seq 2328 nt   +upstreamnt  +downstreamnt
atggcggctctagactccctgtcgctcttcactagcctcggcctgagcgagcagaaggcc
cgcgagacgctcaagaactcggctctgagcgcgcagctgcgcgaggccgctactcaggct
cagcagaccctgggttccaccattgacaaagctaccgggatcctgttatatggcttggcc
tcccgactcagggatacccggcgtctctccttccttgtaagctacatagccagtaagaag
atccacactgagccccagctaagcgctgcccttgagtatgtgcggagtcaccccttggac
cccatcgacactgtggacttcgagcgggaatgtggcgtgggtgtcattgtgaccccagag
cagattgaggaggctgtggaggctgctattaacaggcaccggccccagctcctggtggaa
cgttaccatttcaacatggggctgctgatgggagaggctcgggctgtgctgaagtgggca
gatggcaaaatgatcaagaatgaagtggacatgcaggtcctccaccttctgggccccaag
ttggaggctgatctggagaagaagttcaaggtggcaaaagctcggctagaagaaacagac
cggaggacggcaaaggatgtggtggagaatggcgagactgctgaccagaccctgtctctg
atggagcagctccggggggaggcccttaagttccacaagcctggtgagaactacaagacc
ccaggctatgtggtcactccacacaccatgaatctactaaagcagcacctggagattact
ggtgggcaggtacgtacccggttcccgccagaacccaatggaatcctgcatattggacat
gccaaagccatcaatttcaactttggctatgccaaggccaacaatggcatctgttttctg
cgttttgatgacaccaaccctgagaaggaggaagcaaagttcttcacggccatctgtgac
atggtagcctggctaggctacacaccttacaaagtcacatatgcgtctgactattttgac
cagctatatgcgtgggctgtggagctcatccgcaggggtctggcttatgtgtgccaccag
cgaggagaggagctcaaaggccataatactctgccttcaccctggagagaccgtcccatg
gaggagtcactgctgctctttgaggcaatgcgcaagggcaagttttcagagggcgaggcc
acactacggatgaagctggtgatggaggatggcaagatggaccctgtagcctatcgagtc
aagtatacaccacaccaccgcacaggggacaaatggtgcatctatcccacctacgactac
acacactgcctctgtgactccatcgagcacatcactcactcactctgcaccaaggaattc
caggcccgacgctcttcctacttctggctttgcaatgcactggacgtctattgccctgtg
cagtgggagtatggccgcctcaacctgcactatgctgttgtctctaagaggaagatcctc
cagcttgtagcaactggtgctgtgcgggactgggatgacccacggctctttacactcacg
gccctgcgacggcggggcttcccacctgaggccatcaacaacttctgtgcccgggtggga
gtgactgtggcacaaaccacaatggagccacatcttctagaagcctgtgtgcgtgatgtg
ctgaatgacacagccccacgagccatggctgtgctggagtcactacgggtcatcatcacc
aactttcctgctgccaagtccttggacatccaggtgcccaacttcccagctgatgagacc
aaaggcttccatcaggttccctttgcacccattgtcttcattgagaggactgacttcaag
gaggagccagagccaggatttaagcgcctggcttggggccagcctgtgggcctgaggcat
acaggctacgtcattgagctgcagcatgttgtcaagggccccagtggttgtgtagagagt
ctggaggtgacctgcagacgggcagatgctggagagaagccaaaggcctttattcactgg
gtgtcacagcctttgatgtgtgaggttcgcctctatgagcgactattccagcacaagaac
cctgaagatcctactgaggtgcctggtggatttttaagtgacctgaacctggcatcacta
cacgtggtggatgcagcattagtggactgctctgtggccctggcaaaacccttcgacaag
ttccagtttgagcgtcttggatatttctccgtggatccagacagccatcagggaaagctt
gtctttaaccgaactgtcacactgaaggaagacccaggaaaggtgtga

DBGET integrated database retrieval system