KEGG   Homo sapiens (human): 5860Help
Entry
5860              CDS       T01001                                 

Gene name
QDPR, DHPR, HDHPR, PKU2, SDR33C1
Definition
(RefSeq) quinoid dihydropteridine reductase
  KO
K00357  dihydropteridine reductase [EC:1.5.1.34]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00790  Folate biosynthesis
hsa01100  Metabolic pathways
Network
nt06016  Phenylalanine and tyrosine metabolism
  Element
N00705  Tetrahydrobiopterin biosynthesis, BH4OH to BH4
N00706  QDPR deficiency in tetrahydrobiopterin biosynthesis
Disease
H00167  Phenylketonuria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    5860 (QDPR)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     5860 (QDPR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 Epimerase PRMT5
Motif
Other DBs
NCBI-GeneID: 5860
NCBI-ProteinID: NP_000311
OMIM: 612676
HGNC: 9752
Ensembl: ENSG00000151552
Vega: OTTHUMG00000128537
Pharos: P09417(Tchem)
UniProt: P09417 A0A140VKA9
Structure
PDB: 

Position
4p15.32
AA seq 244 aa AA seqDB search
MAAAAAAGEARRVLVYGGRGALGSRCVQAFRARNWWVASVDVVENEEASASIIVKMTDSF
TEQADQVTAEVGKLLGEEKVDAILCVAGGWAGGNAKSKSLFKNCDLMWKQSIWTSTISSH
LATKHLKEGGLLTLAGAKAALDGTPGMIGYGMAKGAVHQLCQSLAGKNSGMPPGAAAIAV
LPVTLDTPMNRKSMPEADFSSWTPLEFLVETFHDWITGKNRPSSGSLIQVVTTEGRTELT
PAYF
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggcggctgcaggcgaggcgcgccgggtgctggtgtacggcggcaggggc
gctctgggttctcgatgcgtgcaggcttttcgggcccgcaactggtgggttgccagcgtt
gatgtggtggagaatgaagaggccagcgctagcatcattgttaaaatgacagactcgttc
actgagcaggctgaccaggtgactgctgaggttggaaagctcttgggtgaagagaaggtg
gatgcaattctttgcgttgctggaggatgggccgggggcaatgccaaatccaagtctctc
tttaagaactgtgacctgatgtggaagcagagcatatggacatcgaccatctccagccat
ctggctaccaagcatctcaaggaaggaggcctcctgaccttggctggcgcaaaggctgcc
ctggatgggactcctggtatgatcgggtacggcatggccaagggtgctgttcaccagctc
tgccagagcctggctgggaagaacagcggcatgccgcccggggcagccgccatcgctgtg
ctcccggttaccctggataccccgatgaacaggaaatcaatgcctgaggctgacttcagc
tcctggacacccttagaattcctagttgaaactttccatgactggatcacagggaaaaac
cgaccgagctcaggaagcctaatccaggtggtaaccacagaaggaaggacggaactcacc
ccagcatatttttag

DBGET integrated database retrieval system