KEGG   Homo sapiens (human): 5860Help
Entry
5860              CDS       T01001                                 

Gene name
QDPR, DHPR, HDHPR, PKU2, SDR33C1
Definition
(RefSeq) quinoid dihydropteridine reductase
  KO
K00357  dihydropteridine reductase [EC:1.5.1.34]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00790  Folate biosynthesis
hsa01100  Metabolic pathways
Disease
H00167  Phenylketonuria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    5860 (QDPR)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     5860 (QDPR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 Epimerase PRMT5
Motif
Other DBs
NCBI-GeneID: 5860
NCBI-ProteinID: NP_000311
OMIM: 612676
HGNC: 9752
Ensembl: ENSG00000151552
Vega: OTTHUMG00000128537
Pharos: P09417(Tchem)
UniProt: P09417 A0A140VKA9
Structure
PDB: 

Position
4p15.32
AA seq 244 aa AA seqDB search
MAAAAAAGEARRVLVYGGRGALGSRCVQAFRARNWWVASVDVVENEEASASIIVKMTDSF
TEQADQVTAEVGKLLGEEKVDAILCVAGGWAGGNAKSKSLFKNCDLMWKQSIWTSTISSH
LATKHLKEGGLLTLAGAKAALDGTPGMIGYGMAKGAVHQLCQSLAGKNSGMPPGAAAIAV
LPVTLDTPMNRKSMPEADFSSWTPLEFLVETFHDWITGKNRPSSGSLIQVVTTEGRTELT
PAYF
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggcggctgcaggcgaggcgcgccgggtgctggtgtacggcggcaggggc
gctctgggttctcgatgcgtgcaggcttttcgggcccgcaactggtgggttgccagcgtt
gatgtggtggagaatgaagaggccagcgctagcatcattgttaaaatgacagactcgttc
actgagcaggctgaccaggtgactgctgaggttggaaagctcttgggtgaagagaaggtg
gatgcaattctttgcgttgctggaggatgggccgggggcaatgccaaatccaagtctctc
tttaagaactgtgacctgatgtggaagcagagcatatggacatcgaccatctccagccat
ctggctaccaagcatctcaaggaaggaggcctcctgaccttggctggcgcaaaggctgcc
ctggatgggactcctggtatgatcgggtacggcatggccaagggtgctgttcaccagctc
tgccagagcctggctgggaagaacagcggcatgccgcccggggcagccgccatcgctgtg
ctcccggttaccctggataccccgatgaacaggaaatcaatgcctgaggctgacttcagc
tcctggacacccttagaattcctagttgaaactttccatgactggatcacagggaaaaac
cgaccgagctcaggaagcctaatccaggtggtaaccacagaaggaaggacggaactcacc
ccagcatatttttag

DBGET integrated database retrieval system