KEGG   Homo sapiens (human): 5864Help
Entry
5864              CDS       T01001                                 

Gene name
RAB3A
Definition
(RefSeq) RAB3A, member RAS oncogene family
  KO
K07882  Ras-related protein Rab-3A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04721  Synaptic vesicle cycle
hsa04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    5864 (RAB3A)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    5864 (RAB3A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5864 (RAB3A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5864 (RAB3A)
   04031 GTP-binding proteins [BR:hsa04031]
    5864 (RAB3A)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab GTPases
    5864 (RAB3A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   5864 (RAB3A)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Rab Family
   Rab3/27 [OT]
    5864 (RAB3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf SRPRB MMR_HSR1 Gtr1_RagA GTP_EFTU AAA_24 DUF2757 Septin AAA_16
Motif
Other DBs
NCBI-GeneID: 5864
NCBI-ProteinID: NP_002857
OMIM: 179490
HGNC: 9777
Ensembl: ENSG00000105649
Vega: OTTHUMG00000137378
Pharos: P20336(Tbio)
UniProt: P20336 A0A024R7I7
Position
19p13.11
AA seq 220 aa AA seqDB search
MASATDSRYGQKESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFK
VKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQI
KTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLV
DVICEKMSESLDTADPAVTGAKQGPQLSDQQVPPHQDCAC
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggcatccgccacagactcgcgctatgggcagaaggagtcctcggatcagaacttcgac
tacatgttcaagattctcatcatcggcaacagcagcgtgggcaagacgtccttcctcttc
cgctatgctgacgactcgttcacgcctgccttcgtcagcaccgtgggcatcgacttcaag
gtcaagaccatctatcgcaacgacaagaggatcaagctgcagatctgggacacagcaggg
caagagcggtaccggaccatcaccaccgcatactaccggggcgctatgggcttcatcctc
atgtatgacatcaccaacgaggaatccttcaatgcagtgcaggactggtccacccagatc
aagacctactcatgggacaatgcccaggtgctgctggtaggaaacaagtgtgacatggag
gatgagcgggtggtgtcatcagaacgtggccggcagctagctgaccaccttgggttcgag
ttctttgaggcaagcgccaaggacaacattaacgtcaagcagacctttgagcgcctggtg
gatgtcatctgcgagaagatgtccgagtcgttggacacggcggaccctgcggtcacaggc
gccaagcagggcccacagctcagtgaccagcaggtgccaccgcaccaggactgcgcctgc
tga

DBGET integrated database retrieval system