KEGG   Homo sapiens (human): 5865Help
Entry
5865              CDS       T01001                                 

Gene name
RAB3B
Definition
(RefSeq) RAB3B, member RAS oncogene family
  KO
K06108  Ras-related protein Rab-3B
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5865 (RAB3B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5865 (RAB3B)
   04031 GTP-binding proteins [BR:hsa04031]
    5865 (RAB3B)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab GTPases
    5865 (RAB3B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   5865 (RAB3B)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab3/27 [OT]
    5865 (RAB3B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf SRPRB MMR_HSR1 Gtr1_RagA GTP_EFTU DUF2757 AAA_24 AAA_16
Motif
Other DBs
NCBI-GeneID: 5865
NCBI-ProteinID: NP_002858
OMIM: 179510
HGNC: 9778
Ensembl: ENSG00000169213
Vega: OTTHUMG00000008627
Pharos: P20337(Tbio)
UniProt: P20337
Structure
PDB: 

Position
1p32.3
AA seq 219 aa AA seqDB search
MASVTDGKTGVKDASDQNFDYMFKLLIIGNSSVGKTSFLFRYADDTFTPAFVSTVGIDFK
VKTVYRHEKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWATQI
KTYSWDNAQVILVGNKCDMEEERVVPTEKGQLLAEQLGFDFFEASAKENISVRQAFERLV
DAICDKMSDSLDTDPSMLGSSKNTRLSDTPPLLQQNCSC
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggcttcagtgacagatggtaaaactggagtcaaagatgcctctgaccagaattttgac
tacatgtttaaactgcttatcattggcaacagcagtgttggcaagacctccttcctcttc
cgctatgctgatgacacgttcaccccagccttcgttagcaccgtgggcatcgacttcaag
gtgaagacagtctaccgtcacgagaagcgggtgaaactgcagatctgggacacagctggg
caggagcggtaccggaccatcacaacagcctattaccgtggggccatgggcttcattctg
atgtatgacatcaccaatgaagagtccttcaatgctgtccaagactgggctactcagatc
aagacctactcctgggacaatgcacaagttattctggtggggaacaagtgtgacatggag
gaagagagggttgttcccactgagaagggccagctccttgcagagcagcttgggtttgat
ttctttgaagccagtgcaaaggagaacatcagtgtaaggcaggcctttgagcgcctggtg
gatgccatttgtgacaagatgtctgattcgctggacacagacccgtcgatgctgggctcc
tccaagaacacgcgtctctcggacaccccaccgctgctgcagcagaactgctcatgctag

DBGET integrated database retrieval system