KEGG   Homo sapiens (human): 5868
Entry
5868              CDS       T01001                                 

Gene name
RAB5A, RAB5
Definition
(RefSeq) RAB5A, member RAS oncogene family
  KO
K07887  Ras-related protein Rab-5A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04014  Ras signaling pathway
hsa04144  Endocytosis
hsa04145  Phagosome
hsa04962  Vasopressin-regulated water reabsorption
hsa05014  Amyotrophic lateral sclerosis
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05132  Salmonella infection
hsa05146  Amoebiasis
hsa05152  Tuberculosis
Network
nt06125  Membrane trafficking (bacteria)
  Element
N01302  Early endosomal fusion
N01303  Salmonella SopB to Early endosomal fusion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    5868 (RAB5A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    5868 (RAB5A)
   04145 Phagosome
    5868 (RAB5A)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    5868 (RAB5A)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    5868 (RAB5A)
   05152 Tuberculosis
    5868 (RAB5A)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    5868 (RAB5A)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    5868 (RAB5A)
   05022 Pathways of neurodegeneration - multiple diseases
    5868 (RAB5A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5868 (RAB5A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5868 (RAB5A)
   04031 GTP-binding proteins [BR:hsa04031]
    5868 (RAB5A)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab GTPases
    5868 (RAB5A)
 Endosome - Lysosome transport
    5868 (RAB5A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   5868 (RAB5A)
  Exosomal proteins of other body fluids (saliva and urine)
   5868 (RAB5A)
  Exosomal proteins of colorectal cancer cells
   5868 (RAB5A)
  Exosomal proteins of bladder cancer cells
   5868 (RAB5A)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab5/17/22/31 [OT]
    5868 (RAB5A)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 Gtr1_RagA RsgA_GTPase GTP_EFTU AAA_16 MCR_beta BrnT_toxin
Other DBs
NCBI-GeneID: 5868
NCBI-ProteinID: NP_004153
OMIM: 179512
HGNC: 9783
Ensembl: ENSG00000144566
Vega: OTTHUMG00000129889
Pharos: P20339(Tbio)
UniProt: P20339 A0A024R2K1
Structure
PDB: 

Position
3p24.3
AA seq 215 aa
MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQ
TVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQR
QASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKK
LPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN
NT seq 648 nt   +upstreamnt  +downstreamnt
atggctagtcgaggcgcaacaagacccaacgggccaaatacgggaaataaaatatgccag
ttcaaactagtacttctgggagagtccgctgttggcaaatcaagcctagtgcttcgtttt
gtgaaaggccaatttcatgaatttcaagagagtaccattggggctgcttttctaacccaa
actgtatgtcttgatgacactacagtaaagtttgaaatatgggatacagctggtcaagaa
cgataccatagcctagcaccaatgtactacagaggagcacaagcagccatagttgtatat
gatatcacaaatgaggagtcctttgcaagagcaaaaaattgggttaaagaacttcagagg
caagcaagtcctaacattgtaatagctttatcgggaaacaaggccgacctagcaaataaa
agagcagtagatttccaggaagcacagtcctatgcagatgacaatagtttattattcatg
gagacatccgctaaaacatcaatgaatgtaaatgaaatattcatggcaatagctaaaaaa
ttgccaaagaatgaaccacaaaatccaggagcaaattctgccagaggaagaggagtagac
cttaccgaacccacacaaccaaccaggaatcagtgttgtagtaactaa

DBGET integrated database retrieval system