KEGG   Homo sapiens (human): 5868Help
Entry
5868              CDS       T01001                                 

Gene name
RAB5A, RAB5
Definition
(RefSeq) RAB5A, member RAS oncogene family
  KO
K07887  Ras-related protein Rab-5A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04014  Ras signaling pathway
hsa04144  Endocytosis
hsa04145  Phagosome
hsa04962  Vasopressin-regulated water reabsorption
hsa05014  Amyotrophic lateral sclerosis (ALS)
hsa05146  Amoebiasis
hsa05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    5868 (RAB5A)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    5868 (RAB5A)
   04145 Phagosome
    5868 (RAB5A)
 Organismal Systems
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    5868 (RAB5A)
 Human Diseases
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    5868 (RAB5A)
  Infectious diseases
   05152 Tuberculosis
    5868 (RAB5A)
   05146 Amoebiasis
    5868 (RAB5A)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab GTPases
    5868 (RAB5A)
 Endosome - Lysosome transport
    5868 (RAB5A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   5868 (RAB5A)
  Exosomal proteins of other body fluids (saliva and urine)
   5868 (RAB5A)
  Exosomal proteins of colorectal cancer cells
   5868 (RAB5A)
  Exosomal proteins of bladder cancer cells
   5868 (RAB5A)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Rab Family
   Rab5/17/22/31 [OT]
    5868 (RAB5A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf Gtr1_RagA MMR_HSR1 RsgA_GTPase GTP_EFTU AAA_16 MCR_beta BrnT_toxin
Motif
Other DBs
NCBI-GeneID: 5868
NCBI-ProteinID: NP_004153
OMIM: 179512
HGNC: 9783
Ensembl: ENSG00000144566
Vega: OTTHUMG00000129889
Pharos: P20339(Tbio)
UniProt: P20339 A0A024R2K1
Structure
PDB: 

Position
3p24.3
AA seq 215 aa AA seqDB search
MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQ
TVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQR
QASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKK
LPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggctagtcgaggcgcaacaagacccaacgggccaaatacgggaaataaaatatgccag
ttcaaactagtacttctgggagagtccgctgttggcaaatcaagcctagtgcttcgtttt
gtgaaaggccaatttcatgaatttcaagagagtaccattggggctgcttttctaacccaa
actgtatgtcttgatgacactacagtaaagtttgaaatatgggatacagctggtcaagaa
cgataccatagcctagcaccaatgtactacagaggagcacaagcagccatagttgtatat
gatatcacaaatgaggagtcctttgcaagagcaaaaaattgggttaaagaacttcagagg
caagcaagtcctaacattgtaatagctttatcgggaaacaaggccgacctagcaaataaa
agagcagtagatttccaggaagcacagtcctatgcagatgacaatagtttattattcatg
gagacatccgctaaaacatcaatgaatgtaaatgaaatattcatggcaatagctaaaaaa
ttgccaaagaatgaaccacaaaatccaggagcaaattctgccagaggaagaggagtagac
cttaccgaacccacacaaccaaccaggaatcagtgttgtagtaactaa

DBGET integrated database retrieval system