KEGG   Homo sapiens (human): 5868Help
Entry
5868              CDS       T01001                                 

Gene name
RAB5A, RAB5
Definition
(RefSeq) RAB5A, member RAS oncogene family
  KO
K07887  Ras-related protein Rab-5A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04014  Ras signaling pathway
hsa04144  Endocytosis
hsa04145  Phagosome
hsa04962  Vasopressin-regulated water reabsorption
hsa05014  Amyotrophic lateral sclerosis (ALS)
hsa05146  Amoebiasis
hsa05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    5868 (RAB5A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    5868 (RAB5A)
   04145 Phagosome
    5868 (RAB5A)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    5868 (RAB5A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    5868 (RAB5A)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    5868 (RAB5A)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    5868 (RAB5A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5868 (RAB5A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5868 (RAB5A)
   04031 GTP-binding proteins [BR:hsa04031]
    5868 (RAB5A)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab GTPases
    5868 (RAB5A)
 Endosome - Lysosome transport
    5868 (RAB5A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   5868 (RAB5A)
  Exosomal proteins of other body fluids (saliva and urine)
   5868 (RAB5A)
  Exosomal proteins of colorectal cancer cells
   5868 (RAB5A)
  Exosomal proteins of bladder cancer cells
   5868 (RAB5A)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab5/17/22/31 [OT]
    5868 (RAB5A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf Gtr1_RagA MMR_HSR1 RsgA_GTPase GTP_EFTU AAA_16 MCR_beta BrnT_toxin
Motif
Other DBs
NCBI-GeneID: 5868
NCBI-ProteinID: NP_004153
OMIM: 179512
HGNC: 9783
Ensembl: ENSG00000144566
Vega: OTTHUMG00000129889
Pharos: P20339(Tbio)
UniProt: P20339 A0A024R2K1
Structure
PDB: 

Position
3p24.3
AA seq 215 aa AA seqDB search
MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQ
TVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQR
QASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKK
LPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggctagtcgaggcgcaacaagacccaacgggccaaatacgggaaataaaatatgccag
ttcaaactagtacttctgggagagtccgctgttggcaaatcaagcctagtgcttcgtttt
gtgaaaggccaatttcatgaatttcaagagagtaccattggggctgcttttctaacccaa
actgtatgtcttgatgacactacagtaaagtttgaaatatgggatacagctggtcaagaa
cgataccatagcctagcaccaatgtactacagaggagcacaagcagccatagttgtatat
gatatcacaaatgaggagtcctttgcaagagcaaaaaattgggttaaagaacttcagagg
caagcaagtcctaacattgtaatagctttatcgggaaacaaggccgacctagcaaataaa
agagcagtagatttccaggaagcacagtcctatgcagatgacaatagtttattattcatg
gagacatccgctaaaacatcaatgaatgtaaatgaaatattcatggcaatagctaaaaaa
ttgccaaagaatgaaccacaaaatccaggagcaaattctgccagaggaagaggagtagac
cttaccgaacccacacaaccaaccaggaatcagtgttgtagtaactaa

KEGG   Homo sapiens (human): 5869Help
Entry
5869              CDS       T01001                                 

Gene name
RAB5B
Definition
(RefSeq) RAB5B, member RAS oncogene family
  KO
K07888  Ras-related protein Rab-5B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04014  Ras signaling pathway
hsa04144  Endocytosis
hsa04145  Phagosome
hsa04962  Vasopressin-regulated water reabsorption
hsa05146  Amoebiasis
hsa05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    5869 (RAB5B)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    5869 (RAB5B)
   04145 Phagosome
    5869 (RAB5B)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    5869 (RAB5B)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    5869 (RAB5B)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    5869 (RAB5B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5869 (RAB5B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5869 (RAB5B)
   04031 GTP-binding proteins [BR:hsa04031]
    5869 (RAB5B)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab GTPases
    5869 (RAB5B)
 Endosome - Lysosome transport
    5869 (RAB5B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   5869 (RAB5B)
  Exosomal proteins of other body fluids (saliva and urine)
   5869 (RAB5B)
  Exosomal proteins of colorectal cancer cells
   5869 (RAB5B)
  Exosomal proteins of melanoma cells
   5869 (RAB5B)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab5/17/22/31 [OT]
    5869 (RAB5B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf MMR_HSR1 Gtr1_RagA GTP_EFTU RsgA_GTPase AAA_16
Motif
Other DBs
NCBI-GeneID: 5869
NCBI-ProteinID: NP_001238965
OMIM: 179514
HGNC: 9784
Ensembl: ENSG00000111540
Vega: OTTHUMG00000169682
Pharos: P61020(Tbio)
UniProt: P61020 A0A024RB09
Structure
PDB: 

Position
12q13.2
AA seq 215 aa AA seqDB search
MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQ
SVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQR
QASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKK
LPKSEPQNLGGAAGRSRGVDLHEQSQQNKSQCCSN
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgactagcagaagcacagctaggcccaatgggcaaccccaggccagcaaaatttgccag
ttcaaattggtcctgctgggagaatctgcagtgggaaagtcaagcctggtattacgtttt
gtcaaagggcagttccatgagtaccaggagagcaccattggagcggccttcctcacccag
tccgtttgtctagatgacacaacagtgaagtttgagatctgggacacagctgggcaggag
cgatatcacagcttagcccccatgtactacaggggtgcccaagctgcaatcgtggtttac
gacattactaatcaggaaacctttgcccgagcaaagacatgggtgaaggaactacagcga
caggccagtcctagcatcgttattgccctggcagggaacaaagctgacctggccaacaaa
cgtatggtggagtatgaagaggcccaggcatatgcagatgacaacagcttattgttcatg
gagacttcagccaagacagctatgaacgtgaatgatctcttcctggcaatagctaagaag
ttgccaaagagtgaaccccagaatctgggaggtgcagcaggccgaagccggggtgtggat
ctccatgaacagtcccagcagaacaagagccagtgttgtagcaactga

KEGG   Homo sapiens (human): 5878Help
Entry
5878              CDS       T01001                                 

Gene name
RAB5C, L1880, RAB5CL, RAB5L, RABL
Definition
(RefSeq) RAB5C, member RAS oncogene family
  KO
K07889  Ras-related protein Rab-5C
Organism
hsa  Homo sapiens (human)
Pathway
hsa04014  Ras signaling pathway
hsa04144  Endocytosis
hsa04145  Phagosome
hsa04962  Vasopressin-regulated water reabsorption
hsa05146  Amoebiasis
hsa05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    5878 (RAB5C)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    5878 (RAB5C)
   04145 Phagosome
    5878 (RAB5C)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    5878 (RAB5C)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    5878 (RAB5C)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    5878 (RAB5C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5878 (RAB5C)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5878 (RAB5C)
   04031 GTP-binding proteins [BR:hsa04031]
    5878 (RAB5C)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab GTPases
    5878 (RAB5C)
 Endosome - Lysosome transport
    5878 (RAB5C)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   5878 (RAB5C)
  Exosomal proteins of other body fluids (saliva and urine)
   5878 (RAB5C)
  Exosomal proteins of colorectal cancer cells
   5878 (RAB5C)
  Exosomal proteins of bladder cancer cells
   5878 (RAB5C)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab5/17/22/31 [OT]
    5878 (RAB5C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf Gtr1_RagA MMR_HSR1 RsgA_GTPase GTP_EFTU AAA_16
Motif
Other DBs
NCBI-GeneID: 5878
NCBI-ProteinID: NP_004574
OMIM: 604037
HGNC: 9785
Ensembl: ENSG00000108774
Vega: OTTHUMG00000169703
Pharos: P51148(Tbio)
UniProt: P51148 A0A024R1U4
Structure
PDB: 

Position
17q21.2
AA seq 216 aa AA seqDB search
MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLT
QTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQ
RQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAK
KLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSN
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggcgggtcggggaggcgcagcacgacccaatggaccagctgctgggaacaagatctgt
caatttaagctggttctgctgggggagtctgcggtaggcaaatccagcctcgtcctccgc
tttgtcaagggacagtttcacgagtaccaggagagcacaattggagcggccttcctcaca
cagactgtctgcctggatgacacaacagtcaagtttgagatctgggacacagctggacag
gagcggtatcacagcctggcccccatgtactatcggggggcccaggctgccatcgtggtc
tatgacatcaccaacacagatacatttgcacgggccaagaactgggtgaaggagctacag
aggcaggccagccccaacatcgtcattgcactcgcgggtaacaaggcagacctggccagc
aagagagccgtggaattccaggaagcacaagcctatgcagacgacaacagtttgctgttc
atggagacatcagcaaagactgcaatgaacgtgaacgaaatcttcatggcaatagctaag
aagcttcccaagaacgagccccagaatgcaactggtgctccaggccgaaaccgaggtgtg
gacctccaggagaacaacccagccagccggagccagtgctgcagcaactga

DBGET integrated database retrieval system