KEGG   Homo sapiens (human): 5869Help
Entry
5869              CDS       T01001                                 

Gene name
RAB5B
Definition
(RefSeq) RAB5B, member RAS oncogene family
  KO
K07888  Ras-related protein Rab-5B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04014  Ras signaling pathway
hsa04144  Endocytosis
hsa04145  Phagosome
hsa04962  Vasopressin-regulated water reabsorption
hsa05146  Amoebiasis
hsa05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    5869 (RAB5B)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    5869 (RAB5B)
   04145 Phagosome
    5869 (RAB5B)
 Organismal Systems
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    5869 (RAB5B)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    5869 (RAB5B)
   05146 Amoebiasis
    5869 (RAB5B)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab GTPases
    5869 (RAB5B)
 Endosome - Lysosome transport
    5869 (RAB5B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   5869 (RAB5B)
  Exosomal proteins of other body fluids (saliva and urine)
   5869 (RAB5B)
  Exosomal proteins of colorectal cancer cells
   5869 (RAB5B)
  Exosomal proteins of melanoma cells
   5869 (RAB5B)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Rab Family
   Rab5/17/22/31 [OT]
    5869 (RAB5B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf MMR_HSR1 Gtr1_RagA GTP_EFTU RsgA_GTPase AAA_16
Motif
Other DBs
NCBI-GeneID: 5869
NCBI-ProteinID: NP_001238965
OMIM: 179514
HGNC: 9784
Ensembl: ENSG00000111540
Vega: OTTHUMG00000169682
Pharos: P61020(Tbio)
UniProt: P61020 A0A024RB09
Structure
PDB: 

Position
12q13.2
AA seq 215 aa AA seqDB search
MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQ
SVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQR
QASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKK
LPKSEPQNLGGAAGRSRGVDLHEQSQQNKSQCCSN
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgactagcagaagcacagctaggcccaatgggcaaccccaggccagcaaaatttgccag
ttcaaattggtcctgctgggagaatctgcagtgggaaagtcaagcctggtattacgtttt
gtcaaagggcagttccatgagtaccaggagagcaccattggagcggccttcctcacccag
tccgtttgtctagatgacacaacagtgaagtttgagatctgggacacagctgggcaggag
cgatatcacagcttagcccccatgtactacaggggtgcccaagctgcaatcgtggtttac
gacattactaatcaggaaacctttgcccgagcaaagacatgggtgaaggaactacagcga
caggccagtcctagcatcgttattgccctggcagggaacaaagctgacctggccaacaaa
cgtatggtggagtatgaagaggcccaggcatatgcagatgacaacagcttattgttcatg
gagacttcagccaagacagctatgaacgtgaatgatctcttcctggcaatagctaagaag
ttgccaaagagtgaaccccagaatctgggaggtgcagcaggccgaagccggggtgtggat
ctccatgaacagtcccagcagaacaagagccagtgttgtagcaactga

DBGET integrated database retrieval system