KEGG   Homo sapiens (human): 587Help
Entry
587               CDS       T01001                                 

Gene name
BCAT2, BCAM, BCATM, BCT2, PP18
Definition
(RefSeq) branched chain amino acid transaminase 2
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00270  Cysteine and methionine metabolism
hsa00280  Valine, leucine and isoleucine degradation
hsa00290  Valine, leucine and isoleucine biosynthesis
hsa00770  Pantothenate and CoA biosynthesis
hsa01100  Metabolic pathways
hsa01210  2-Oxocarboxylic acid metabolism
hsa01230  Biosynthesis of amino acids
Module
hsa_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    587 (BCAT2)
   00280 Valine, leucine and isoleucine degradation
    587 (BCAT2)
   00290 Valine, leucine and isoleucine biosynthesis
    587 (BCAT2)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    587 (BCAT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hsa01007]
    587 (BCAT2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     587 (BCAT2)
Amino acid related enzymes [BR:hsa01007]
 Aminotransferase (transaminase)
  Class IV
   587 (BCAT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_4
Motif
Other DBs
NCBI-GeneID: 587
NCBI-ProteinID: NP_001181
OMIM: 113530
HGNC: 977
Ensembl: ENSG00000105552
Vega: OTTHUMG00000183327
Pharos: O15382(Tbio)
UniProt: O15382
Structure
PDB: 

Position
19q13.33
AA seq 392 aa AA seqDB search
MAAAALGQIWARKLLSVPWLLCGPRRYASSSFKAADLQLEMTQKPHKKPGPGEPLVFGKT
FTDHMLMVEWNDKGWGQPRIQPFQNLTLHPASSSLHYSLQLFEGMKAFKGKDQQVRLFRP
WLNMDRMLRSAMRLCLPSFDKLELLECIRRLIEVDKDWVPDAAGTSLYVRPVLIGNEPSL
GVSQPTRALLFVILCPVGAYFPGGSVTPVSLLADPAFIRAWVGGVGNYKLGGNYGPTVLV
QQEALKRGCEQVLWLYGPDHQLTEVGTMNIFVYWTHEDGVLELVTPPLNGVILPGVVRQS
LLDMAQTWGEFRVVERTITMKQLLRALEEGRVREVFGSGTACQVCPVHRILYKDRNLHIP
TMENGPELILRFQKELKEIQYGIRAHEWMFPV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggccgcagccgctctggggcagatctgggcacgaaagcttctctctgtcccttggctt
ctgtgtggtcccagaagatatgcctcctccagtttcaaggctgcagacctgcagctggaa
atgacacagaagcctcataagaagcctggccccggcgagcccctggtgtttgggaagaca
tttaccgaccacatgctgatggtggaatggaatgacaagggctggggccagccccgaatc
cagcccttccagaacctcacgctgcacccagcctcctccagcctccactactccctgcag
ctgtttgagggcatgaaggcgttcaaaggcaaagaccagcaggtgcgcctcttccgcccc
tggctcaacatggaccggatgctgcgctcagccatgcgcctgtgcctgccgagtttcgac
aagctggagttgctggagtgcatccgccggctcatcgaagtggacaaggactgggtcccc
gatgccgccggcaccagcctctatgtgcggcctgtgctcattgggaacgagccctcgctg
ggtgtcagccagcccacgcgcgcgctcctgttcgtcattctctgcccagtgggtgcctac
ttccctggaggctccgtgaccccggtctccctcctggccgacccagccttcatccgggcc
tgggtgggcggggtcggcaactacaagttaggtgggaattatgggcccaccgtgttagtg
caacaggaggcactcaagcggggctgtgaacaggtcctctggctgtatgggcccgaccac
cagctcaccgaggtgggaaccatgaacatctttgtctactggacccacgaagatggggtg
ctggagctggtgacgcccccgctgaatggtgttatcctgcctggagtggtcagacagagt
ctactggacatggctcagacctggggtgagttccgggtggtggagcgcacgatcaccatg
aagcagttgctgcgggccctggaggagggccgcgtgcgggaagtctttggctcgggcacc
gcttgccaggtctgcccagtgcaccgaatcctgtacaaagacaggaacctccacattccc
accatggaaaatgggcctgagctgatcctccgcttccagaaggagctgaaggagatccag
tacggaatcagagcccacgagtggatgttcccggtgtga

DBGET integrated database retrieval system