KEGG   Homo sapiens (human): 5871Help
Entry
5871              CDS       T01001                                 

Gene name
MAP4K2, BL44, GCK, RAB8IP
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase kinase 2
  KO
K04414  mitogen-activated protein kinase kinase kinase kinase 2 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    5871 (MAP4K2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5871 (MAP4K2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     5871 (MAP4K2)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: STE group
  STE20 family
   5871 (MAP4K2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CNH Pkinase Pkinase_Tyr Kinase-like
Motif
Other DBs
NCBI-GeneID: 5871
NCBI-ProteinID: NP_004570
OMIM: 603166
HGNC: 6864
Ensembl: ENSG00000168067
Vega: OTTHUMG00000045328
Pharos: Q12851(Tchem)
UniProt: Q12851 A0A024R567
Position
11q13.1
AA seq 820 aa AA seqDB search
MALLRDVSLQDPRDRFELLQRVGAGTYGDVYKARDTVTSELAAVKIVKLDPGDDISSLQQ
EITILRECRHPNVVAYIGSYLRNDRLWICMEFCGGGSLQEIYHATGPLEERQIAYVCREA
LKGLHHLHSQGKIHRDIKGANLLLTLQGDVKLADFGVSGELTASVAKRRSFIGTPYWMAP
EVAAVERKGGYNELCDVWALGITAIELGELQPPLFHLHPMRALMLMSKSSFQPPKLRDKT
RWTQNFHHFLKLALTKNPKKRPTAEKLLQHPFTTQQLPRALLTQLLDKASDPHLGTPSPE
DCELETYDMFPDTIHSRGQHGPAERTPSEIQFHQVKFGAPRRKETDPLNEPWEEEWTLLG
KEELSGSLLQSVQEALEERSLTIRSASEFQELDSPDDTMGTIKRAPFLGPLPTDPPAEEP
LSSPPGTLPPPPSGPNSSPLLPTAWATMKQREDPERSSCHGLPPTPKVHMGACFSKVFNG
CPLRIHAAVTWIHPVTRDQFLVVGAEEGIYTLNLHELHEDTLEKLISHRCSWLYCVNNVL
LSLSGKSTHIWAHDLPGLFEQRRLQQQVPLSIPTNRLTQRIIPRRFALSTKIPDTKGCLQ
CRVVRNPYTGATFLLAALPTSLLLLQWYEPLQKFLLLKNFSSPLPSPAGMLEPLVLDGKE
LPQVCVGAEGPEGPGCRVLFHVLPLEAGLTPDILIPPEGIPGSAQQVIQVDRDTILVSFE
RCVRIVNMQGEPTATLAPELTFDFPIETVVCLQDSVLAFWSHGMQGRSLDTNEVTQEITD
ETRIFRVLGAHRDIILESIPTDNPEAHSNLYILTGHQSTY
NT seq 2463 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgctgcgggatgtgtcgctgcaggacccgcgggaccgcttcgagctgctgcag
cgcgtgggggccgggacctatggcgacgtctacaaggcccgcgacacggtcacgtccgaa
ctggccgccgtgaagatagtcaagctagacccaggggacgacatcagctccctccagcag
gaaatcaccatcctgcgtgagtgccgccaccccaatgtggtggcctacattggcagctac
ctcaggaatgaccgcttgtggatctgcatggagttctgcggagggggctccctgcaggag
atttaccatgccactgggcccctggaggagcggcagattgcctacgtctgccgagaggca
ctgaaggggctccaccacctgcattctcaggggaagatccacagagacatcaagggagcc
aaccttctcctcactctccagggagatgtcaaactggctgactttggggtgtcaggcgag
ctgacagcgtctgtggccaagaggaggtctttcattgggactccctactggatggctccc
gaggtggctgctgtggagcgcaaaggtggctacaatgagctatgtgacgtctgggccctg
ggcatcactgccattgagctgggcgagctgcagccccctctgttccacctgcaccccatg
agggccctgatgctcatgtcgaagagcagcttccagccgcccaaactgagagataagact
cgctggacccagaatttccaccactttctcaaactggccctgaccaagaatcctaagaag
aggccgacagcagagaagctcctgcagcacccgttcacgactcagcagctccctcgggcc
ctcctcacacagctgctggacaaagccagtgaccctcatctggggaccccctcccctgag
gactgtgagctggagacctatgacatgtttccagacaccattcactcccgggggcagcac
ggcccagccgagaggaccccctcggagatccagtttcaccaggtgaaatttggcgcccca
cgcaggaaggaaactgacccactgaatgagccgtgggaggaagagtggacactactggga
aaggaagagttgagtgggagcctgctgcagtcggtccaggaggccctggaggaaaggagt
ctgactattcggtcagcctcagaattccaggagctggactccccagacgataccatggga
accatcaagcgggccccgttcctagggccactccccactgaccctccagcagaggagcct
ctgtccagtcccccaggaaccctgcccccacctccttcaggccccaacagctccccactg
ctgcccacggcctgggccaccatgaagcagcgggaggatcctgagaggtcatcctgccac
gggctccccccaactcccaaggtgcatatgggcgcctgcttctccaaggtcttcaatggc
tgccccctgcggatccacgctgctgtcacctggattcaccctgttactcgggaccagttc
ctggtggtaggggccgaggaaggcatctacacactcaacctgcatgaactgcatgaggat
acgctggagaagctgatttcacatcgctgctcctggctctactgcgtgaacaacgtgctg
ctgtcactctcagggaaatccacgcacatctgggcccatgacctcccaggcctgtttgag
cagcggaggctacagcaacaggttcccctctccatccccaccaaccgcctcacccagcgc
atcatccccaggcgctttgctctgtccaccaagattcctgacaccaaaggctgcttgcag
tgtcgtgtggtgcggaacccctacacgggtgccaccttcctgctggccgccctgcccacc
agcctgctcctgctgcagtggtatgagccgctgcagaagtttctgctgctgaagaacttc
tccagccctctgcccagcccagctgggatgctggagccgctggtgctggatgggaaggag
ctgccgcaggtgtgtgttggggccgaggggcctgaggggcccggctgccgcgtcctgttc
catgtcctgcccctggaggctggcctgacgcccgacatcctcatcccacctgaggggatc
ccaggctcggcccagcaggtgatccaggtggacagggacacaatcctagtcagctttgaa
cgctgtgtgaggattgtcaacatgcagggcgagcccacggccacactggcacctgagctg
acctttgatttccccatcgagactgtggtgtgcctgcaggacagtgtgctggccttctgg
agccatgggatgcaaggccgaagcctggataccaatgaggtgacccaggagatcacagat
gaaacaaggatcttccgagtgcttggggcccacagagacatcatcctggagagcattccc
actgacaacccagaggcgcacagcaacctctacatcctcacgggccaccagagcacctac
taa

DBGET integrated database retrieval system