KEGG   Homo sapiens (human): 5876
Entry
5876              CDS       T01001                                 

Gene name
RABGGTB, GGTB
Definition
(RefSeq) Rab geranylgeranyltransferase subunit beta
  KO
K05956  geranylgeranyl transferase type-2 subunit beta [EC:2.5.1.60]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:hsa01006]
    5876 (RABGGTB)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5876 (RABGGTB)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.60  protein geranylgeranyltransferase type II
     5876 (RABGGTB)
Prenyltransferases [BR:hsa01006]
 Protein prenylation
  Rab geranylgeranyltransferase
   5876 (RABGGTB)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    5876 (RABGGTB)
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
    5876 (RABGGTB)
SSDB
Motif
Pfam: Prenyltrans SQHop_cyclase_C
Other DBs
NCBI-GeneID: 5876
NCBI-ProteinID: NP_004573
OMIM: 179080
HGNC: 9796
Ensembl: ENSG00000137955
Vega: OTTHUMG00000009786
Pharos: P53611(Tbio)
UniProt: P53611 Q6IB63 A8KAJ2
Structure
PDB: 
6O60

Position
1p31.1
AA seq 331 aa
MGTPQKDVIIKSDAPDTLLLEKHADYIASYGSKKDDYEYCMSEYLRMSGIYWGLTVMDLM
GQLHRMNREEILAFIKSCQHECGGISASIGHDPHLLYTLSAVQILTLYDSINVIDVNKVV
EYVKGLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGG
FGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVC
YSWWVLASLKIIGRLHWIDREKLRNFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSL
LGEEQIKPVNPVFCMPEEVLQRVNVQPELVS
NT seq 996 nt   +upstreamnt  +downstreamnt
atgggcactccacagaaggatgttattatcaagtcagatgcaccggacactttgttattg
gagaaacatgcagattatatcgcatcctatggctcaaagaaagatgattatgaatactgt
atgtctgagtatttgagaatgagtggcatctattggggtctgacagtaatggatctcatg
ggacaacttcatcgcatgaatagagaagagattctggcatttattaagtcttgccaacat
gaatgtggtggaataagtgctagtatcggacatgatcctcatcttttatacactcttagt
gctgtccagattcttacgctgtatgacagtattaatgttattgacgtaaataaagttgtg
gaatatgttaaaggtctacagaaagaagatggttcttttgctggagatatttggggagaa
attgacacaagattctctttttgtgcggtggcaactttggctttgttggggaagcttgat
gctattaatgtggaaaaggcaatcgaatttgttttatcctgtatgaactttgacggtgga
tttggttgcagaccaggttctgaatcccatgctgggcagatctattgttgcacaggattt
ctggcaattacaagtcagttgcatcaagtaaattctgatttacttggctggtggctttgt
gaacgacaattaccctcaggcgggctcaatggaaggccggagaagttaccagatgtatgc
tactcatggtgggtcctggcttccctaaagataattggaagacttcattggattgataga
gagaaactgcgtaatttcattttagcatgtcaagatgaagaaacggggggatttgcagac
aggccaggagatatggtggatccttttcataccttatttggaattgctggattgtcactt
ttgggagaagaacagattaaacctgttaatcctgtcttttgcatgcctgaagaagtgctt
cagagagtgaatgttcagcctgagctagtgagctag

DBGET integrated database retrieval system