KEGG   Homo sapiens (human): 5878
Entry
5878              CDS       T01001                                 
Symbol
RAB5C, L1880, RAB5CL, RAB5L, RABL
Name
(RefSeq) RAB5C, member RAS oncogene family
  KO
K07889  Ras-related protein Rab-5C
Organism
hsa  Homo sapiens (human)
Pathway
hsa04014  Ras signaling pathway
hsa04144  Endocytosis
hsa04145  Phagosome
hsa04962  Vasopressin-regulated water reabsorption
hsa05132  Salmonella infection
hsa05146  Amoebiasis
hsa05152  Tuberculosis
Network
nt06125  Membrane trafficking (bacteria)
  Element
N01302  Early endosomal fusion
N01303  Salmonella SopB to Early endosomal fusion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    5878 (RAB5C)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    5878 (RAB5C)
   04145 Phagosome
    5878 (RAB5C)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    5878 (RAB5C)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    5878 (RAB5C)
   05152 Tuberculosis
    5878 (RAB5C)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    5878 (RAB5C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5878 (RAB5C)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5878 (RAB5C)
   04031 GTP-binding proteins [BR:hsa04031]
    5878 (RAB5C)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab GTPases
    5878 (RAB5C)
 Endosome - Lysosome transport
    5878 (RAB5C)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   5878 (RAB5C)
  Exosomal proteins of other body fluids (saliva and urine)
   5878 (RAB5C)
  Exosomal proteins of colorectal cancer cells
   5878 (RAB5C)
  Exosomal proteins of bladder cancer cells
   5878 (RAB5C)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab5/17/22/31 [OT]
    5878 (RAB5C)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 Gtr1_RagA RsgA_GTPase GTP_EFTU AAA_16
Other DBs
NCBI-GeneID: 5878
NCBI-ProteinID: NP_004574
OMIM: 604037
HGNC: 9785
Ensembl: ENSG00000108774
Pharos: P51148(Tbio)
UniProt: P51148 A0A024R1U4
Structure
Position
17:complement(42124979..42154989)
AA seq 216 aa
MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLT
QTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQ
RQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAK
KLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSN
NT seq 651 nt   +upstreamnt  +downstreamnt
atggcgggtcggggaggcgcagcacgacccaatggaccagctgctgggaacaagatctgt
caatttaagctggttctgctgggggagtctgcggtaggcaaatccagcctcgtcctccgc
tttgtcaagggacagtttcacgagtaccaggagagcacaattggagcggccttcctcaca
cagactgtctgcctggatgacacaacagtcaagtttgagatctgggacacagctggacag
gagcggtatcacagcctggcccccatgtactatcggggggcccaggctgccatcgtggtc
tatgacatcaccaacacagatacatttgcacgggccaagaactgggtgaaggagctacag
aggcaggccagccccaacatcgtcattgcactcgcgggtaacaaggcagacctggccagc
aagagagccgtggaattccaggaagcacaagcctatgcagacgacaacagtttgctgttc
atggagacatcagcaaagactgcaatgaacgtgaacgaaatcttcatggcaatagctaag
aagcttcccaagaacgagccccagaatgcaactggtgctccaggccgaaaccgaggtgtg
gacctccaggagaacaacccagccagccggagccagtgctgcagcaactga

DBGET integrated database retrieval system