| Entry |
|
| Symbol |
RAC1, MIG5, MRD48, Rac-1, TC-25, p21-Rac1
|
| Name |
(RefSeq) Rac family small GTPase 1
|
| KO |
| K04392 | Ras-related C3 botulinum toxin substrate 1 |
|
| Organism |
|
| Pathway |
| hsa04613 | Neutrophil extracellular trap formation |
| hsa04620 | Toll-like receptor signaling pathway |
| hsa04650 | Natural killer cell mediated cytotoxicity |
| hsa04662 | B cell receptor signaling pathway |
| hsa04664 | Fc epsilon RI signaling pathway |
| hsa04666 | Fc gamma R-mediated phagocytosis |
| hsa04670 | Leukocyte transendothelial migration |
| hsa04810 | Regulation of actin cytoskeleton |
| hsa04932 | Non-alcoholic fatty liver disease |
| hsa04933 | AGE-RAGE signaling pathway in diabetic complications |
| hsa05022 | Pathways of neurodegeneration - multiple diseases |
| hsa05100 | Bacterial invasion of epithelial cells |
| hsa05120 | Epithelial cell signaling in Helicobacter pylori infection |
| hsa05130 | Pathogenic Escherichia coli infection |
| hsa05163 | Human cytomegalovirus infection |
| hsa05167 | Kaposi sarcoma-associated herpesvirus infection |
| hsa05170 | Human immunodeficiency virus 1 infection |
| hsa05208 | Chemical carcinogenesis - reactive oxygen species |
| hsa05418 | Fluid shear stress and atherosclerosis |
|
| Network |
|
| Element |
| N00153 | CCR/CXCR-GNB/G-PI3K-RAC signaling pathway |
| N00394 | HCMV gH to ITGA/B-RhoA signaling pathway |
| N00433 | CXCR4-GNB/G-RAC signaling pathway |
| N00951 | ITGA/B-RHOG-RAC signaling pathway |
| N00952 | Shigella IpgB1 to ITGA/B-RHOG-RAC signaling pathway |
| N01068 | ITGA/B-FAK-RAC signaling pathway |
| N01069 | Shigella IpgB1 to ITGA/B-FAK-RAC signaling pathway |
| N01077 | Shigella IcsB to ITGA/B-FAK-RAC signaling pathway |
| N01086 | Escherichia EspT to RAC signaling pathway |
| N01087 | Escherichia EspW to RAC signaling pathway |
| N01090 | IGG-FCGR-RAC signaling pathway |
| N01102 | Yersinia YopE to ITGA/B-RHOG-RAC signaling pathway |
| N01103 | Yersinia YpkA to IGG-FCGR-RAC signaling pathway |
| N01119 | RAC/CDC42-PAK-ERK signaling pathway |
| N01120 | Salmonella SptP to RAC/CDC42-PAK-ERK signaling pathway |
| N01127 | Salmonella SopE to Inflammasome signaling pathway |
| N01128 | Salmonella SopE to RAC signaling pathway |
| N01204 | PRNP-PI3K-NOX2 signaling pathway |
| N01205 | Scrapie conformation PrPSc to PRNP-PI3K-NOX2 signaling pathway |
| N01761 | Activation of CRK-DOCK-Rac1 pathway |
| N01763 | MEGF10-mediated recognition and engulfment |
| N01779 | Continual efferocytosis enhanced by the AC-derived arginine and ornithine |
| N01837 | Regulation of neurite extension, NAV1-TRIO |
|
| Disease |
| H00773 | Autosomal dominant intellectual developmental disorder |
|
| Drug target |
|
| Brite |
KEGG Orthology (KO) [BR:hsa00001]
09130 Environmental Information Processing
09132 Signal transduction
04010 MAPK signaling pathway
5879 (RAC1)
04014 Ras signaling pathway
5879 (RAC1)
04015 Rap1 signaling pathway
5879 (RAC1)
04310 Wnt signaling pathway
5879 (RAC1)
04370 VEGF signaling pathway
5879 (RAC1)
04071 Sphingolipid signaling pathway
5879 (RAC1)
04024 cAMP signaling pathway
5879 (RAC1)
04151 PI3K-Akt signaling pathway
5879 (RAC1)
09140 Cellular Processes
09141 Transport and catabolism
04145 Phagosome
5879 (RAC1)
04148 Efferocytosis
5879 (RAC1)
09144 Cellular community - eukaryotes
04510 Focal adhesion
5879 (RAC1)
04520 Adherens junction
5879 (RAC1)
04530 Tight junction
5879 (RAC1)
09142 Cell motility
04810 Regulation of actin cytoskeleton
5879 (RAC1)
09150 Organismal Systems
09151 Immune system
04613 Neutrophil extracellular trap formation
5879 (RAC1)
04620 Toll-like receptor signaling pathway
5879 (RAC1)
04650 Natural killer cell mediated cytotoxicity
5879 (RAC1)
04662 B cell receptor signaling pathway
5879 (RAC1)
04664 Fc epsilon RI signaling pathway
5879 (RAC1)
04666 Fc gamma R-mediated phagocytosis
5879 (RAC1)
04670 Leukocyte transendothelial migration
5879 (RAC1)
04062 Chemokine signaling pathway
5879 (RAC1)
09154 Digestive system
04972 Pancreatic secretion
5879 (RAC1)
09156 Nervous system
04722 Neurotrophin signaling pathway
5879 (RAC1)
09158 Development and regeneration
04360 Axon guidance
5879 (RAC1)
04380 Osteoclast differentiation
5879 (RAC1)
09160 Human Diseases
09161 Cancer: overview
05200 Pathways in cancer
5879 (RAC1)
05205 Proteoglycans in cancer
5879 (RAC1)
05208 Chemical carcinogenesis - reactive oxygen species
5879 (RAC1)
05203 Viral carcinogenesis
5879 (RAC1)
05231 Choline metabolism in cancer
5879 (RAC1)
09162 Cancer: specific types
05210 Colorectal cancer
5879 (RAC1)
05212 Pancreatic cancer
5879 (RAC1)
05211 Renal cell carcinoma
5879 (RAC1)
09172 Infectious disease: viral
05170 Human immunodeficiency virus 1 infection
5879 (RAC1)
05163 Human cytomegalovirus infection
5879 (RAC1)
05167 Kaposi sarcoma-associated herpesvirus infection
5879 (RAC1)
05169 Epstein-Barr virus infection
5879 (RAC1)
09171 Infectious disease: bacterial
05120 Epithelial cell signaling in Helicobacter pylori infection
5879 (RAC1)
05130 Pathogenic Escherichia coli infection
5879 (RAC1)
05132 Salmonella infection
5879 (RAC1)
05131 Shigellosis
5879 (RAC1)
05135 Yersinia infection
5879 (RAC1)
05100 Bacterial invasion of epithelial cells
5879 (RAC1)
09164 Neurodegenerative disease
05014 Amyotrophic lateral sclerosis
5879 (RAC1)
05020 Prion disease
5879 (RAC1)
05022 Pathways of neurodegeneration - multiple diseases
5879 (RAC1)
09166 Cardiovascular disease
05417 Lipid and atherosclerosis
5879 (RAC1)
05418 Fluid shear stress and atherosclerosis
5879 (RAC1)
05415 Diabetic cardiomyopathy
5879 (RAC1)
05416 Viral myocarditis
5879 (RAC1)
09167 Endocrine and metabolic disease
04932 Non-alcoholic fatty liver disease
5879 (RAC1)
04933 AGE-RAGE signaling pathway in diabetic complications
5879 (RAC1)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:hsa04131]
5879 (RAC1)
09183 Protein families: signaling and cellular processes
04147 Exosome [BR:hsa04147]
5879 (RAC1)
04031 GTP-binding proteins [BR:hsa04031]
5879 (RAC1)
Membrane trafficking [BR:hsa04131]
Exocytosis
Small GTPases and associated proteins
Rho GTPases
5879 (RAC1)
Endocytosis
Lipid raft mediated endocytosis
Arf6-dependent endocytosis
5879 (RAC1)
Macropinocytosis
Ras GTPases
5879 (RAC1)
Others
NADPH oxidases (Nox) and associated proteins
Nox associated proteins
5879 (RAC1)
Exosome [BR:hsa04147]
Exosomal proteins
Exosomal proteins of haemopoietic cells (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
5879 (RAC1)
Exosomal proteins of other body fluids (saliva and urine)
5879 (RAC1)
Exosomal proteins of colorectal cancer cells
5879 (RAC1)
Exosomal proteins of bladder cancer cells
5879 (RAC1)
GTP-binding proteins [BR:hsa04031]
Small (monomeric) G-proteins
Rho Family
Rac/Cdc42 [OT]
5879 (RAC1)
|
| SSDB |
|
| Motif |
|
| Other DBs |
|
| Structure |
|
| Position |
7:6374527..6403967
|
| AA seq |
192 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR
DDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKRKRKCLLL |
| NT seq |
579 nt +upstreamnt +downstreamnt
atgcaggccatcaagtgtgtggtggtgggagacggagctgtaggtaaaacttgcctactg
atcagttacacaaccaatgcatttcctggagaatatatccctactgtctttgacaattat
tctgccaatgttatggtagatggaaaaccggtgaatctgggcttatgggatacagctgga
caagaagattatgacagattacgccccctatcctatccgcaaacagatgtgttcttaatt
tgcttttcccttgtgagtcctgcatcatttgaaaatgtccgtgcaaagtggtatcctgag
gtgcggcaccactgtcccaacactcccatcatcctagtgggaactaaacttgatcttagg
gatgataaagacacgatcgagaaactgaaggagaagaagctgactcccatcacctatccg
cagggtctagccatggctaaggagattggtgctgtaaaatacctggagtgctcggcgctc
acacagcgaggcctcaagacagtgtttgacgaagcgatccgagcagtcctctgcccgcct
cccgtgaagaagaggaagagaaaatgcctgctgttgtaa |