KEGG   Homo sapiens (human): 5879Help
Entry
5879              CDS       T01001                                 

Gene name
RAC1, MIG5, MRD48, Rac-1, TC-25, p21-Rac1
Definition
(RefSeq) Rac family small GTPase 1
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04024  cAMP signaling pathway
hsa04062  Chemokine signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04145  Phagosome
hsa04151  PI3K-Akt signaling pathway
hsa04310  Wnt signaling pathway
hsa04360  Axon guidance
hsa04370  VEGF signaling pathway
hsa04380  Osteoclast differentiation
hsa04510  Focal adhesion
hsa04520  Adherens junction
hsa04530  Tight junction
hsa04620  Toll-like receptor signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa04662  B cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa04670  Leukocyte transendothelial migration
hsa04722  Neurotrophin signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa04972  Pancreatic secretion
hsa05014  Amyotrophic lateral sclerosis (ALS)
hsa05100  Bacterial invasion of epithelial cells
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05163  Human cytomegalovirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05205  Proteoglycans in cancer
hsa05210  Colorectal cancer
hsa05211  Renal cell carcinoma
hsa05212  Pancreatic cancer
hsa05231  Choline metabolism in cancer
hsa05416  Viral myocarditis
hsa05418  Fluid shear stress and atherosclerosis
Network
N00153  CXCR-GNB/G-PI3K-RAC signaling pathway
N00178  KSHV vGPCR to GNB/G-PI3K-JNK signaling pathway
N00221  HTLV-1 Tax to host-cell-protein activation
N00394  HCMV gH to ITGA/B-RhoA signaling pathway
N00433  CXCR4-GNB/G-RAC signaling pathway
N00434  HIV gp120 to CXCR4-GNB/G-RAC signaling pathway
Disease
H00773  Autosomal dominant mental retardation
Drug target
Plitidepsin: D11032
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    5879 (RAC1)
   04015 Rap1 signaling pathway
    5879 (RAC1)
   04010 MAPK signaling pathway
    5879 (RAC1)
   04310 Wnt signaling pathway
    5879 (RAC1)
   04370 VEGF signaling pathway
    5879 (RAC1)
   04071 Sphingolipid signaling pathway
    5879 (RAC1)
   04024 cAMP signaling pathway
    5879 (RAC1)
   04151 PI3K-Akt signaling pathway
    5879 (RAC1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    5879 (RAC1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    5879 (RAC1)
   04520 Adherens junction
    5879 (RAC1)
   04530 Tight junction
    5879 (RAC1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    5879 (RAC1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    5879 (RAC1)
   04650 Natural killer cell mediated cytotoxicity
    5879 (RAC1)
   04662 B cell receptor signaling pathway
    5879 (RAC1)
   04664 Fc epsilon RI signaling pathway
    5879 (RAC1)
   04666 Fc gamma R-mediated phagocytosis
    5879 (RAC1)
   04670 Leukocyte transendothelial migration
    5879 (RAC1)
   04062 Chemokine signaling pathway
    5879 (RAC1)
  09154 Digestive system
   04972 Pancreatic secretion
    5879 (RAC1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    5879 (RAC1)
  09158 Development
   04360 Axon guidance
    5879 (RAC1)
   04380 Osteoclast differentiation
    5879 (RAC1)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    5879 (RAC1)
   05231 Choline metabolism in cancer
    5879 (RAC1)
   05205 Proteoglycans in cancer
    5879 (RAC1)
   05203 Viral carcinogenesis
    5879 (RAC1)
  09162 Cancers: Specific types
   05210 Colorectal cancer
    5879 (RAC1)
   05212 Pancreatic cancer
    5879 (RAC1)
   05211 Renal cell carcinoma
    5879 (RAC1)
  09164 Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    5879 (RAC1)
  09166 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    5879 (RAC1)
   05416 Viral myocarditis
    5879 (RAC1)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    5879 (RAC1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    5879 (RAC1)
  09171 Infectious diseases: Bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    5879 (RAC1)
   05132 Salmonella infection
    5879 (RAC1)
   05131 Shigellosis
    5879 (RAC1)
   05100 Bacterial invasion of epithelial cells
    5879 (RAC1)
  09172 Infectious diseases: Viral
   05170 Human immunodeficiency virus 1 infection
    5879 (RAC1)
   05163 Human cytomegalovirus infection
    5879 (RAC1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    5879 (RAC1)
   05169 Epstein-Barr virus infection
    5879 (RAC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5879 (RAC1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5879 (RAC1)
   04031 GTP-binding proteins [BR:hsa04031]
    5879 (RAC1)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    5879 (RAC1)
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    5879 (RAC1)
  Phagocytosis
   NADPH oxidase complex
    5879 (RAC1)
  Macropinocytosis
   Ras GTPases
    5879 (RAC1)
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    5879 (RAC1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   5879 (RAC1)
  Exosomal proteins of other body fluids (saliva and urine)
   5879 (RAC1)
  Exosomal proteins of colorectal cancer cells
   5879 (RAC1)
  Exosomal proteins of bladder cancer cells
   5879 (RAC1)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    5879 (RAC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf GTP_EFTU CagD
Motif
Other DBs
NCBI-GeneID: 5879
NCBI-ProteinID: NP_008839
OMIM: 602048
HGNC: 9801
Ensembl: ENSG00000136238
Vega: OTTHUMG00000023540
Pharos: P63000(Tbio)
UniProt: P63000 A4D2P1
Structure
PDB: 

Position
7p22.1
AA seq 192 aa AA seqDB search
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR
DDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKRKRKCLLL
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgtggtggtgggagacggagctgtaggtaaaacttgcctactg
atcagttacacaaccaatgcatttcctggagaatatatccctactgtctttgacaattat
tctgccaatgttatggtagatggaaaaccggtgaatctgggcttatgggatacagctgga
caagaagattatgacagattacgccccctatcctatccgcaaacagatgtgttcttaatt
tgcttttcccttgtgagtcctgcatcatttgaaaatgtccgtgcaaagtggtatcctgag
gtgcggcaccactgtcccaacactcccatcatcctagtgggaactaaacttgatcttagg
gatgataaagacacgatcgagaaactgaaggagaagaagctgactcccatcacctatccg
cagggtctagccatggctaaggagattggtgctgtaaaatacctggagtgctcggcgctc
acacagcgaggcctcaagacagtgtttgacgaagcgatccgagcagtcctctgcccgcct
cccgtgaagaagaggaagagaaaatgcctgctgttgtaa

KEGG   Homo sapiens (human): 5880Help
Entry
5880              CDS       T01001                                 

Gene name
RAC2, EN-7, Gx, HSPC022, p21-Rac2
Definition
(RefSeq) Rac family small GTPase 2
  KO
K07860  Ras-related C3 botulinum toxin substrate 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04024  cAMP signaling pathway
hsa04062  Chemokine signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04310  Wnt signaling pathway
hsa04360  Axon guidance
hsa04370  VEGF signaling pathway
hsa04510  Focal adhesion
hsa04520  Adherens junction
hsa04650  Natural killer cell mediated cytotoxicity
hsa04662  B cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa04670  Leukocyte transendothelial migration
hsa04810  Regulation of actin cytoskeleton
hsa05163  Human cytomegalovirus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05210  Colorectal cancer
hsa05212  Pancreatic cancer
hsa05231  Choline metabolism in cancer
hsa05416  Viral myocarditis
hsa05418  Fluid shear stress and atherosclerosis
Network
N00394  HCMV gH to ITGA/B-RhoA signaling pathway
N00433  CXCR4-GNB/G-RAC signaling pathway
N00434  HIV gp120 to CXCR4-GNB/G-RAC signaling pathway
Disease
H00099  Leukocyte adhesion deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    5880 (RAC2)
   04015 Rap1 signaling pathway
    5880 (RAC2)
   04010 MAPK signaling pathway
    5880 (RAC2)
   04310 Wnt signaling pathway
    5880 (RAC2)
   04370 VEGF signaling pathway
    5880 (RAC2)
   04071 Sphingolipid signaling pathway
    5880 (RAC2)
   04024 cAMP signaling pathway
    5880 (RAC2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    5880 (RAC2)
   04520 Adherens junction
    5880 (RAC2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    5880 (RAC2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    5880 (RAC2)
   04662 B cell receptor signaling pathway
    5880 (RAC2)
   04664 Fc epsilon RI signaling pathway
    5880 (RAC2)
   04666 Fc gamma R-mediated phagocytosis
    5880 (RAC2)
   04670 Leukocyte transendothelial migration
    5880 (RAC2)
   04062 Chemokine signaling pathway
    5880 (RAC2)
  09158 Development
   04360 Axon guidance
    5880 (RAC2)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    5880 (RAC2)
   05231 Choline metabolism in cancer
    5880 (RAC2)
  09162 Cancers: Specific types
   05210 Colorectal cancer
    5880 (RAC2)
   05212 Pancreatic cancer
    5880 (RAC2)
  09166 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    5880 (RAC2)
   05416 Viral myocarditis
    5880 (RAC2)
  09172 Infectious diseases: Viral
   05170 Human immunodeficiency virus 1 infection
    5880 (RAC2)
   05163 Human cytomegalovirus infection
    5880 (RAC2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hsa04031]
    5880 (RAC2)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    5880 (RAC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf
Motif
Other DBs
NCBI-GeneID: 5880
NCBI-ProteinID: NP_002863
OMIM: 602049
HGNC: 9802
Ensembl: ENSG00000128340
Vega: OTTHUMG00000150540
Pharos: P15153(Tbio)
UniProt: P15153 A0A024R1P2 V9H0H7
Structure
PDB: 

Position
22q13.1
AA seq 192 aa AA seqDB search
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLR
DDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQ
PTRQQKRACSLL
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgtggtggtgggagatggggccgtgggcaagacctgccttctc
atcagctacaccaccaacgcctttcccggagagtacatccccaccgtgtttgacaactat
tcagccaatgtgatggtggacagcaagccagtgaacctggggctgtgggacactgctggg
caggaggactacgaccgtctccggccgctctcctatccacagacggacgtcttcctcatc
tgcttctccctcgtcagcccagcctcttatgagaacgtccgcgccaagtggttcccagaa
gtgcggcaccactgccccagcacacccatcatcctggtgggcaccaagctggacctgcgg
gacgacaaggacaccatcgagaaactgaaggagaagaagctggctcccatcacctacccg
cagggcctggcactggccaaggagattgactcggtgaaatacctggagtgctcagctctc
acccagagaggcctgaaaaccgtgttcgacgaggccatccgggccgtgctgtgccctcag
cccacgcggcagcagaagcgcgcctgcagcctcctctag

KEGG   Homo sapiens (human): 5881Help
Entry
5881              CDS       T01001                                 

Gene name
RAC3
Definition
(RefSeq) Rac family small GTPase 3
  KO
K07861  Ras-related C3 botulinum toxin substrate 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04024  cAMP signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04310  Wnt signaling pathway
hsa04360  Axon guidance
hsa04370  VEGF signaling pathway
hsa04510  Focal adhesion
hsa04520  Adherens junction
hsa04650  Natural killer cell mediated cytotoxicity
hsa04662  B cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa05163  Human cytomegalovirus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05210  Colorectal cancer
hsa05212  Pancreatic cancer
hsa05231  Choline metabolism in cancer
hsa05416  Viral myocarditis
hsa05418  Fluid shear stress and atherosclerosis
Network
N00394  HCMV gH to ITGA/B-RhoA signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    5881 (RAC3)
   04015 Rap1 signaling pathway
    5881 (RAC3)
   04010 MAPK signaling pathway
    5881 (RAC3)
   04310 Wnt signaling pathway
    5881 (RAC3)
   04370 VEGF signaling pathway
    5881 (RAC3)
   04071 Sphingolipid signaling pathway
    5881 (RAC3)
   04024 cAMP signaling pathway
    5881 (RAC3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    5881 (RAC3)
   04520 Adherens junction
    5881 (RAC3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    5881 (RAC3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    5881 (RAC3)
   04662 B cell receptor signaling pathway
    5881 (RAC3)
   04664 Fc epsilon RI signaling pathway
    5881 (RAC3)
  09158 Development
   04360 Axon guidance
    5881 (RAC3)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    5881 (RAC3)
   05231 Choline metabolism in cancer
    5881 (RAC3)
  09162 Cancers: Specific types
   05210 Colorectal cancer
    5881 (RAC3)
   05212 Pancreatic cancer
    5881 (RAC3)
  09166 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    5881 (RAC3)
   05416 Viral myocarditis
    5881 (RAC3)
  09172 Infectious diseases: Viral
   05170 Human immunodeficiency virus 1 infection
    5881 (RAC3)
   05163 Human cytomegalovirus infection
    5881 (RAC3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hsa04031]
    5881 (RAC3)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    5881 (RAC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf
Motif
Other DBs
NCBI-GeneID: 5881
NCBI-ProteinID: NP_005043
OMIM: 602050
HGNC: 9803
Ensembl: ENSG00000169750
Vega: OTTHUMG00000178455
Pharos: P60763(Tbio)
UniProt: P60763
Structure
PDB: 

Position
17q25.3
AA seq 192 aa AA seqDB search
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLR
DDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKPGKKCTVF
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccatcaagtgcgtggtggtcggcgacggcgccgtggggaagacatgcttgctg
atcagctacacgaccaacgccttccccggagagtacatccccaccgtttttgacaactac
tctgccaacgtgatggtggacgggaaaccagtcaacttggggctgtgggacacagcgggt
caggaggactacgatcggctgcggccactctcctacccccaaactgacgtctttctgatc
tgcttctctctggtgagcccggcctccttcgagaatgttcgtgccaagtggtacccggag
gtgcggcaccactgcccccacacgcccatcctcctggtgggcaccaagctggacctccgc
gacgacaaggacaccattgagcggctgcgggacaagaagctggcacccatcacctaccca
cagggcctggccatggcccgggagattggctctgtgaaatacctggagtgctcagccctg
acccagcggggcctgaagacagtgtttgacgaggcgatccgcgcggtgctctgcccgccc
ccagtgaagaagccggggaagaagtgcaccgtcttctag

KEGG   Homo sapiens (human): 998Help
Entry
998               CDS       T01001                                 

Gene name
CDC42, CDC42Hs, G25K, TKS
Definition
(RefSeq) cell division cycle 42
  KO
K04393  cell division control protein 42
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04062  Chemokine signaling pathway
hsa04144  Endocytosis
hsa04360  Axon guidance
hsa04370  VEGF signaling pathway
hsa04510  Focal adhesion
hsa04520  Adherens junction
hsa04530  Tight junction
hsa04660  T cell receptor signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa04670  Leukocyte transendothelial migration
hsa04722  Neurotrophin signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa04912  GnRH signaling pathway
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05100  Bacterial invasion of epithelial cells
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05205  Proteoglycans in cancer
hsa05211  Renal cell carcinoma
hsa05212  Pancreatic cancer
Network
N00221  HTLV-1 Tax to host-cell-protein activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    998 (CDC42)
   04015 Rap1 signaling pathway
    998 (CDC42)
   04010 MAPK signaling pathway
    998 (CDC42)
   04370 VEGF signaling pathway
    998 (CDC42)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    998 (CDC42)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    998 (CDC42)
   04520 Adherens junction
    998 (CDC42)
   04530 Tight junction
    998 (CDC42)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    998 (CDC42)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    998 (CDC42)
   04666 Fc gamma R-mediated phagocytosis
    998 (CDC42)
   04670 Leukocyte transendothelial migration
    998 (CDC42)
   04062 Chemokine signaling pathway
    998 (CDC42)
  09152 Endocrine system
   04912 GnRH signaling pathway
    998 (CDC42)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    998 (CDC42)
  09158 Development
   04360 Axon guidance
    998 (CDC42)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    998 (CDC42)
   05205 Proteoglycans in cancer
    998 (CDC42)
   05203 Viral carcinogenesis
    998 (CDC42)
  09162 Cancers: Specific types
   05212 Pancreatic cancer
    998 (CDC42)
   05211 Renal cell carcinoma
    998 (CDC42)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    998 (CDC42)
   04933 AGE-RAGE signaling pathway in diabetic complications
    998 (CDC42)
  09171 Infectious diseases: Bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    998 (CDC42)
   05130 Pathogenic Escherichia coli infection
    998 (CDC42)
   05132 Salmonella infection
    998 (CDC42)
   05131 Shigellosis
    998 (CDC42)
   05100 Bacterial invasion of epithelial cells
    998 (CDC42)
  09172 Infectious diseases: Viral
   05165 Human papillomavirus infection
    998 (CDC42)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    998 (CDC42)
   03036 Chromosome and associated proteins [BR:hsa03036]
    998 (CDC42)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    998 (CDC42)
   04031 GTP-binding proteins [BR:hsa04031]
    998 (CDC42)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    998 (CDC42)
 Endocytosis
  Lipid raft mediated endocytosis
   GRAF1-dependent endocytosis
    998 (CDC42)
  Macropinocytosis
   Ras GTPases
    998 (CDC42)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    998 (CDC42)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   998 (CDC42)
  Exosomal proteins of breast milk
   998 (CDC42)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    998 (CDC42)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf PET117 GTP_EFTU
Motif
Other DBs
NCBI-GeneID: 998
NCBI-ProteinID: NP_001034891
OMIM: 116952
HGNC: 1736
Ensembl: ENSG00000070831
Vega: OTTHUMG00000002753
Pharos: P60953(Tchem)
UniProt: P60953 A0A024RAE4
Structure
PDB: 

Position
1p36.12
AA seq 191 aa AA seqDB search
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG
QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR
DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPP
EPKKSRRCVLL
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgcagacaattaagtgtgttgttgtgggcgatggtgctgttggtaaaacatgtctcctg
atatcctacacaacaaacaaatttccatcggaatatgtaccgactgtttttgacaactat
gcagtcacagttatgattggtggagaaccatatactcttggactttttgatactgcaggg
caagaggattatgacagattacgaccgctgagttatccacaaacagatgtatttctagtc
tgtttttcagtggtctctccatcttcatttgaaaacgtgaaagaaaagtgggtgcctgag
ataactcaccactgtccaaagactcctttcttgcttgttgggactcaaattgatctcaga
gatgacccctctactattgagaaacttgccaagaacaaacagaagcctatcactccagag
actgctgaaaagctggcccgtgacctgaaggctgtcaagtatgtggagtgttctgcactt
acacagaaaggcctaaagaatgtatttgacgaagcaatattggctgccctggagcctcca
gaaccgaagaagagccgcaggtgtgtgctgctatga

DBGET integrated database retrieval system