KEGG   Homo sapiens (human): 5880Help
Entry
5880              CDS       T01001                                 

Gene name
RAC2, EN-7, Gx, HSPC022, p21-Rac2
Definition
(RefSeq) Rac family small GTPase 2
  KO
K07860  Ras-related C3 botulinum toxin substrate 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04024  cAMP signaling pathway
hsa04062  Chemokine signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04310  Wnt signaling pathway
hsa04360  Axon guidance
hsa04370  VEGF signaling pathway
hsa04510  Focal adhesion
hsa04520  Adherens junction
hsa04650  Natural killer cell mediated cytotoxicity
hsa04662  B cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa04670  Leukocyte transendothelial migration
hsa04810  Regulation of actin cytoskeleton
hsa05163  Human cytomegalovirus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05210  Colorectal cancer
hsa05212  Pancreatic cancer
hsa05231  Choline metabolism in cancer
hsa05416  Viral myocarditis
hsa05418  Fluid shear stress and atherosclerosis
Network
N00394  HCMV gH to ITGA/B-RhoA signaling pathway
N00433  CXCR4-GNB/G-RAC signaling pathway
N00434  HIV gp120 to CXCR4-GNB/G-RAC signaling pathway
Disease
H00099  Leukocyte adhesion deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    5880 (RAC2)
   04015 Rap1 signaling pathway
    5880 (RAC2)
   04010 MAPK signaling pathway
    5880 (RAC2)
   04310 Wnt signaling pathway
    5880 (RAC2)
   04370 VEGF signaling pathway
    5880 (RAC2)
   04071 Sphingolipid signaling pathway
    5880 (RAC2)
   04024 cAMP signaling pathway
    5880 (RAC2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    5880 (RAC2)
   04520 Adherens junction
    5880 (RAC2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    5880 (RAC2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    5880 (RAC2)
   04662 B cell receptor signaling pathway
    5880 (RAC2)
   04664 Fc epsilon RI signaling pathway
    5880 (RAC2)
   04666 Fc gamma R-mediated phagocytosis
    5880 (RAC2)
   04670 Leukocyte transendothelial migration
    5880 (RAC2)
   04062 Chemokine signaling pathway
    5880 (RAC2)
  09158 Development
   04360 Axon guidance
    5880 (RAC2)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    5880 (RAC2)
   05231 Choline metabolism in cancer
    5880 (RAC2)
  09162 Cancers: Specific types
   05210 Colorectal cancer
    5880 (RAC2)
   05212 Pancreatic cancer
    5880 (RAC2)
  09166 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    5880 (RAC2)
   05416 Viral myocarditis
    5880 (RAC2)
  09172 Infectious diseases: Viral
   05170 Human immunodeficiency virus 1 infection
    5880 (RAC2)
   05163 Human cytomegalovirus infection
    5880 (RAC2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hsa04031]
    5880 (RAC2)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    5880 (RAC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf
Motif
Other DBs
NCBI-GeneID: 5880
NCBI-ProteinID: NP_002863
OMIM: 602049
HGNC: 9802
Ensembl: ENSG00000128340
Vega: OTTHUMG00000150540
Pharos: P15153(Tbio)
UniProt: P15153 A0A024R1P2 V9H0H7
Structure
PDB: 

Position
22q13.1
AA seq 192 aa AA seqDB search
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLR
DDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQ
PTRQQKRACSLL
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgtggtggtgggagatggggccgtgggcaagacctgccttctc
atcagctacaccaccaacgcctttcccggagagtacatccccaccgtgtttgacaactat
tcagccaatgtgatggtggacagcaagccagtgaacctggggctgtgggacactgctggg
caggaggactacgaccgtctccggccgctctcctatccacagacggacgtcttcctcatc
tgcttctccctcgtcagcccagcctcttatgagaacgtccgcgccaagtggttcccagaa
gtgcggcaccactgccccagcacacccatcatcctggtgggcaccaagctggacctgcgg
gacgacaaggacaccatcgagaaactgaaggagaagaagctggctcccatcacctacccg
cagggcctggcactggccaaggagattgactcggtgaaatacctggagtgctcagctctc
acccagagaggcctgaaaaccgtgttcgacgaggccatccgggccgtgctgtgccctcag
cccacgcggcagcagaagcgcgcctgcagcctcctctag

DBGET integrated database retrieval system