KEGG   Homo sapiens (human): 5881Help
Entry
5881              CDS       T01001                                 

Gene name
RAC3
Definition
(RefSeq) Rac family small GTPase 3
  KO
K07861  Ras-related C3 botulinum toxin substrate 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04024  cAMP signaling pathway
hsa04062  Chemokine signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04310  Wnt signaling pathway
hsa04360  Axon guidance
hsa04370  VEGF signaling pathway
hsa04510  Focal adhesion
hsa04520  Adherens junction
hsa04650  Natural killer cell mediated cytotoxicity
hsa04662  B cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa05135  Yersinia infection
hsa05163  Human cytomegalovirus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05210  Colorectal cancer
hsa05212  Pancreatic cancer
hsa05231  Choline metabolism in cancer
hsa05416  Viral myocarditis
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06124  Chemokine signaling (viruses)
nt06135  Cytoskeletal regulation (viruses)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06167  Human cytomegalovirus (HCMV)
  Element
N00394  HCMV gH to ITGA/B-RhoA signaling pathway
N00433  CXCR4-GNB/G-RAC signaling pathway
N00434  HIV gp120 to CXCR4-GNB/G-RAC signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    5881 (RAC3)
   04015 Rap1 signaling pathway
    5881 (RAC3)
   04010 MAPK signaling pathway
    5881 (RAC3)
   04310 Wnt signaling pathway
    5881 (RAC3)
   04370 VEGF signaling pathway
    5881 (RAC3)
   04071 Sphingolipid signaling pathway
    5881 (RAC3)
   04024 cAMP signaling pathway
    5881 (RAC3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    5881 (RAC3)
   04520 Adherens junction
    5881 (RAC3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    5881 (RAC3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    5881 (RAC3)
   04662 B cell receptor signaling pathway
    5881 (RAC3)
   04664 Fc epsilon RI signaling pathway
    5881 (RAC3)
   04062 Chemokine signaling pathway
    5881 (RAC3)
  09158 Development and regeneration
   04360 Axon guidance
    5881 (RAC3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    5881 (RAC3)
   05231 Choline metabolism in cancer
    5881 (RAC3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    5881 (RAC3)
   05212 Pancreatic cancer
    5881 (RAC3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    5881 (RAC3)
   05416 Viral myocarditis
    5881 (RAC3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    5881 (RAC3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    5881 (RAC3)
   05163 Human cytomegalovirus infection
    5881 (RAC3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hsa04031]
    5881 (RAC3)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    5881 (RAC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf
Motif
Other DBs
NCBI-GeneID: 5881
NCBI-ProteinID: NP_005043
OMIM: 602050
HGNC: 9803
Ensembl: ENSG00000169750
Vega: OTTHUMG00000178455
Pharos: P60763(Tbio)
UniProt: P60763
Structure
PDB: 

Position
17q25.3
AA seq 192 aa AA seqDB search
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLR
DDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKPGKKCTVF
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccatcaagtgcgtggtggtcggcgacggcgccgtggggaagacatgcttgctg
atcagctacacgaccaacgccttccccggagagtacatccccaccgtttttgacaactac
tctgccaacgtgatggtggacgggaaaccagtcaacttggggctgtgggacacagcgggt
caggaggactacgatcggctgcggccactctcctacccccaaactgacgtctttctgatc
tgcttctctctggtgagcccggcctccttcgagaatgttcgtgccaagtggtacccggag
gtgcggcaccactgcccccacacgcccatcctcctggtgggcaccaagctggacctccgc
gacgacaaggacaccattgagcggctgcgggacaagaagctggcacccatcacctaccca
cagggcctggccatggcccgggagattggctctgtgaaatacctggagtgctcagccctg
acccagcggggcctgaagacagtgtttgacgaggcgatccgcgcggtgctctgcccgccc
ccagtgaagaagccggggaagaagtgcaccgtcttctag

DBGET integrated database retrieval system