KEGG   Homo sapiens (human): 5883Help
Entry
5883              CDS       T01001                                 

Gene name
RAD9A, RAD9
Definition
(RefSeq) RAD9 checkpoint clamp component A
  KO
K10994  cell cycle checkpoint control protein RAD9A [EC:3.1.11.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    5883 (RAD9A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    5883 (RAD9A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.2  exodeoxyribonuclease III
     5883 (RAD9A)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  Check point factors
   Rad9-Hus1-Rad1 complex
    5883 (RAD9A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rad9
Motif
Other DBs
NCBI-GeneID: 5883
NCBI-ProteinID: NP_004575
OMIM: 603761
HGNC: 9827
Ensembl: ENSG00000172613
Vega: OTTHUMG00000167670
Pharos: Q99638(Tbio)
UniProt: Q99638
Structure
PDB: 

Position
11q13.2
AA seq 391 aa AA seqDB search
MKCLVTGGNVKVLGKAVHSLSRIGDELYLEPLEDGLSLRTVNSSRSAYACFLFAPLFFQQ
YQAATPGQDLLRCKILMKSFLSVFRSLAMLEKTVEKCCISLNGRSSRLVVQLHCKFGVRK
THNLSFQDCESLQAVFDPASCPHMLRAPARVLGEAVLPFSPALAEVTLGIGRGRRVILRS
YHEEEADSTAKAMVTEMCLGEEDFQQLQAQEGVAITFCLKEFRGLLSFAESANLNLSIHF
DAPGRPAIFTIKDSLLDGHFVLATLSDTDSHSQDLGSPERHQPVPQLQAHSTPHPDDFAN
DDIDSYMIAMETTIGNEGSRVLPSISLSPGPQPPKSPGPHSEEEDEAEPSTVPGTPPPKK
FRSLFFGSILAPVRSPQGPSPVLAEDSEGEG
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgcctggtcacgggcggcaacgtgaaggtgctcggcaaggccgtccactccctg
tcccgcatcggggacgagctctacctggaacccttggaggacgggctctccctccggacg
gtgaactcctcccgctctgcctatgcctgctttctctttgccccgctcttcttccagcaa
taccaggcagccacccctggtcaggacctgctgcgctgtaagatcctgatgaagtctttc
ctgtctgtcttccgctcactggcgatgctggagaagacggtggaaaaatgctgcatctcc
ctgaatggccggagcagccgcctggtggtccagctgcattgcaagttcggggtgcggaag
actcacaacctgtccttccaggactgtgagtccctgcaggccgtcttcgacccagcctcg
tgcccccacatgctccgcgccccagcacgggttctgggggaggctgttctgcccttctct
cctgcactggctgaagtgacgctgggcattggccgtggccgcagggtcatcctgcgcagc
taccacgaggaggaggcagacagcactgccaaagccatggtgactgagatgtgccttgga
gaggaggatttccagcagctgcaggcccaggaaggggtggccatcactttctgcctcaag
gaattccgggggctcctgagctttgcagagtcagcaaacttgaatcttagcattcatttt
gatgctccaggcaggcccgccatcttcaccatcaaggactctttgctggacggccacttt
gtcttggccacactctcagacaccgactcgcactcccaggacctgggctccccagagcgt
caccagccagtgcctcagctccaggctcacagcacaccccacccggacgactttgccaat
gacgacattgactcttacatgatcgccatggaaaccactataggcaatgagggctcgcgg
gtgctgccctccatttccctttcacctggcccccagccccccaagagccccggtccccac
tccgaggaggaagatgaggctgagcccagtacagtgcctgggactcccccacccaagaag
ttccgctcactgttcttcggctccatcctggcccctgtacgctccccccagggccccagc
cctgtgctggcggaagacagtgagggtgaaggctga

DBGET integrated database retrieval system