KEGG   Homo sapiens (human): 5884Help
Entry
5884              CDS       T01001                                 

Gene name
RAD17, CCYC, HRAD17, R24L, RAD17SP, RAD24
Definition
(RefSeq) RAD17 checkpoint clamp loader component
  KO
K06662  cell cycle checkpoint protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    5884 (RAD17)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  Check point factors
   HRAD17(Rad24)-RFC complex
    5884 (RAD17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rad17 AAA_18 AAA_16 AAA RuvB_N AAA_22 AAA_28 ABC_tran Viral_helicase1 AAA_14 AAA_assoc_2 T2SSE AAA_19 AAA_11 AAA_17 AAA_30 DMA RNA_helicase dNK ATPase_2 Zeta_toxin NTPase_1 AAA_5 AAA_33 Mvb12
Motif
Other DBs
NCBI-GeneID: 5884
NCBI-ProteinID: NP_579917
OMIM: 603139
HGNC: 9807
Ensembl: ENSG00000152942
Vega: OTTHUMG00000099357
Pharos: O75943(Tbio)
UniProt: O75943
Position
5q13.2
AA seq 681 aa AA seqDB search
MSKTFLRPKVSSTKVTDWVDPSFDDFLECSGVSTITATSLGVNNSSHRRKNGPSTLESSR
FPARKRGNLSSLEQIYGLENSKEYLSENEPWVDKYKPETQHELAVHKKKIEEVETWLKAQ
VLERQPKQGGSILLITGPPGCGKTTTLKILSKEHGIQVQEWINPVLPDFQKDDFKGMFNT
ESSFHMFPYQSQIAVFKEFLLRATKYNKLQMLGDDLRTDKKIILVEDLPNQFYRDSHTLH
EVLRKYVRIGRCPLIFIISDSLSGDNNQRLLFPKEIQEECSISNISFNPVAPTIMMKFLN
RIVTIEANKNGGKITVPDKTSLELLCQGCSGDIRSAINSLQFSSSKGENNLRPRKKGMSL
KSDAVLSKSKRRKKPDRVFENQEVQAIGGKDVSLFLFRALGKILYCKRASLTELDSPRLP
SHLSEYERDTLLVEPEEVVEMSHMPGDLFNLYLHQNYIDFFMEIDDIVRASEFLSFADIL
SGDWNTRSLLREYSTSIATRGVMHSNKARGYAHCQGGGSSFRPLHKPQWFLINKKYRENC
LAAKALFPDFCLPALCLQTQLLPYLALLTIPMRNQAQISFIQDIGRLPLKRHFGRLKMEA
LTDREHGMIDPDSGDEAQLNGGHSAEESLGEPTQATVPETWSLPLSQNSASELPASQPQP
FSAQGDMEENIIIEDYESDGT
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaacttttcttagaccaaaggtatcttccacaaaggtaacagactgggttgac
ccatcatttgatgattttctagagtgtagtggcgtctctactattactgccacatcatta
ggtgtgaataactcaagtcatagaagaaaaaatgggccttctacattagaaagcagcaga
tttccagcgagaaaaagaggaaatctatcttccttagaacagatttatggtttagaaaat
tcaaaagaatatctgtctgaaaatgaaccatgggtggataaatataaaccagaaactcag
catgaacttgctgtgcataaaaagaaaattgaagaagtcgaaacctggttaaaagctcaa
gttttagaaaggcaaccaaaacagggtggatctattttattaataacaggtcctcctgga
tgtggaaagacaacgaccttaaaaatactatcaaaggagcatggtattcaagtacaagag
tggattaatccagttttaccagacttccaaaaagatgatttcaaggggatgtttaatact
gaatcaagcttccatatgtttccctatcagtctcagatagcagttttcaaagagtttcta
ctaagagcgacaaagtataacaagttacaaatgcttggagatgatctgagaactgataag
aagataattctggttgaagatttacctaaccagttttatcgggattctcatactttacat
gaagttctaaggaagtatgtgaggattggtcgatgtcctcttatatttataatctcggac
agtctcagtggagataataatcaaaggttattgtttcccaaagaaattcaggaagagtgt
tctatctcaaatattagtttcaaccctgtggcaccaacaattatgatgaaatttcttaat
cgaatagtgactatagaagctaacaagaatggaggaaaaattactgtccctgacaaaact
tctctagagttgctctgtcagggatgttctggtgatatcagaagtgcaataaacagcctc
cagttttcttcttcaaaaggagaaaacaacttacggccaaggaaaaaaggaatgtcttta
aaatcagatgctgtgctgtcaaaatcaaaacgaagaaaaaaacctgatagggtttttgaa
aatcaagaggtccaagctattggtggcaaagatgtttctctgtttctcttcagagctttg
gggaaaattctatattgtaaaagagcatctttaacagaattagactcacctcggttgccc
tctcatttatcagaatatgaacgggatacattacttgttgaacctgaggaggtagtagaa
atgtcacacatgcctggagacttatttaatttatatcttcaccaaaactacatagatttc
ttcatggaaattgatgatattgtgagagccagtgaatttctgagttttgcagatatcctc
agtggtgactggaatacacgctctttactcagggaatatagcacatctatagctacgaga
ggtgtgatgcattccaacaaagcccgaggatatgctcattgccaaggaggaggatcaagt
tttcgacccttgcacaaacctcagtggtttctaataaataaaaagtatcgggaaaattgc
ctggcagcaaaagcactttttcctgacttctgcctaccagctttatgcctccaaactcag
ctattgccataccttgctctactaaccattccaatgagaaatcaagctcagatttctttt
atccaagatattggaaggctccctctgaagcgacactttggaagattgaaaatggaagcc
ctgactgacagggaacatggaatgatagaccctgacagcggagatgaagcccagcttaat
ggaggacattctgcagaggaatctctgggtgaacccactcaagccactgtgccggaaacc
tggtctcttcctttgagtcagaatagtgccagtgaactgcctgctagccagccccagccc
ttttcagcccaaggagacatggaagaaaacataataatagaagactacgagagtgatggg
acatag

DBGET integrated database retrieval system