KEGG   Homo sapiens (human): 5888Help
Entry
5888              CDS       T01001                                 

Gene name
RAD51, BRCC5, FANCR, HRAD51, HsRad51, HsT16930, MRMV2, RAD51A, RECA
Definition
(RefSeq) RAD51 recombinase
  KO
K04482  DNA repair protein RAD51
Organism
hsa  Homo sapiens (human)
Pathway
hsa03440  Homologous recombination
hsa03460  Fanconi anemia pathway
hsa05200  Pathways in cancer
hsa05212  Pancreatic cancer
Disease
H00238  Fanconi anemia
H01287  Congenital mirror movements
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    5888 (RAD51)
   03460 Fanconi anemia pathway
    5888 (RAD51)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    5888 (RAD51)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    5888 (RAD51)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5888 (RAD51)
   04121 Ubiquitin system [BR:hsa04121]
    5888 (RAD51)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    5888 (RAD51)
Membrane trafficking [BR:hsa04131]
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    5888 (RAD51)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   BRCC complex
    5888 (RAD51)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA complex
     5888 (RAD51)
    RecA family proteins
     5888 (RAD51)
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     5888 (RAD51)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rad51 AAA_25 RecA HHH_5 ATPase HhH-GPD HHH ssDNA_TraI_N
Motif
Other DBs
NCBI-GeneID: 5888
NCBI-ProteinID: NP_002866
OMIM: 179617
HGNC: 9817
Ensembl: ENSG00000051180
Vega: OTTHUMG00000130067
Pharos: Q06609(Tchem)
UniProt: Q06609
Structure
PDB: 

Position
15q15.1
AA seq 339 aa AA seqDB search
MAMQMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKEL
INIKGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETG
SITEMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGL
SGSDVLDNVAYARAFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSA
RQMHLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRL
YLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggcaatgcagatgcagcttgaagcaaatgcagatacttcagtggaagaagaaagcttt
ggcccacaacccatttcacggttagagcagtgtggcataaatgccaacgatgtgaagaaa
ttggaagaagctggattccatactgtggaggctgttgcctatgcgccaaagaaggagcta
ataaatattaagggaattagtgaagccaaagctgataaaattctggctgaggcagctaaa
ttagttccaatgggtttcaccactgcaactgaattccaccaaaggcggtcagagatcata
cagattactactggctccaaagagcttgacaaactacttcaaggtggaattgagactgga
tctatcacagaaatgtttggagaattccgaactgggaagacccagatctgtcatacgcta
gctgtcacctgccagcttcccattgaccggggtggaggtgaaggaaaggccatgtacatt
gacactgagggtacctttaggccagaacggctgctggcagtggctgagaggtatggtctc
tctggcagtgatgtcctggataatgtagcatatgctcgagcgttcaacacagaccaccag
acccagctcctttatcaagcatcagccatgatggtagaatctaggtatgcactgcttatt
gtagacagtgccaccgccctttacagaacagactactcgggtcgaggtgagctttcagcc
aggcagatgcacttggccaggtttctgcggatgcttctgcgactcgctgatgagtttggt
gtagcagtggtaatcactaatcaggtggtagctcaagtggatggagcagcgatgtttgct
gctgatcccaaaaaacctattggaggaaatatcatcgcccatgcatcaacaaccagattg
tatctgaggaaaggaagaggggaaaccagaatctgcaaaatctacgactctccctgtctt
cctgaagctgaagctatgttcgccattaatgcagatggagtgggagatgccaaagactga

DBGET integrated database retrieval system