KEGG   Homo sapiens (human): 5891Help
Entry
5891              CDS       T01001                                 

Gene name
MOK, RAGE, RAGE-1, RAGE1, STK30
Definition
(RefSeq) MOK protein kinase
  KO
K08830  renal tumor antigen [EC:2.7.11.22]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5891 (MOK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     5891 (MOK)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CMGC group
  RCK family [OT]
   5891 (MOK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like FTA2 Kdo
Motif
Other DBs
NCBI-GeneID: 5891
NCBI-ProteinID: NP_055041
OMIM: 605762
HGNC: 9833
Ensembl: ENSG00000080823
Vega: OTTHUMG00000164896
Pharos: Q9UQ07(Tbio)
UniProt: Q9UQ07
Position
14q32.31
AA seq 419 aa AA seqDB search
MKNYKAIGKIGEGTFSEVMKMQSLRDGNYYACKQMKQRFESIEQVNNLREIQALRRLNPH
PNILMLHEVVFDRKSGSLALICELMDMNIYELIRGRRYPLSEKKIMHYMYQLCKSLDHIH
RNGIFHRDVKPENILIKQDVLKLGDFGSCRSVYSKQPYTEYISTRWYRAPECLLTDGFYT
YKMDLWSAGCVFYEIASLQPLFPGVNELDQISKIHDVIGTPAQKILTKFKQSRAMNFDFP
FKKGSGIPLLTTNLSPQCLSLLHAMVAYDPDERIAAHQALQHPYFQEQRKTEKRALGSHR
KAGFPEHPVAPEPLSNSCQISKEGRKQKQSLKQEEDRPKRRGPAYVMELPKLKLSGVVRL
SSYSSPTLQSVLGSGTNGRVPVLRPLKCIPASKKTDPQKDLKPAPQQCRLPTIVRKGGR
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgaagaactataaagcaattggcaaaataggagagggaacgttttctgaagttatgaag
atgcaaagcctgagagatggaaactactatgcatgtaaacaaatgaagcagcgctttgaa
agtattgagcaagtcaacaacctacgagagatccaagcactgaggcgcctgaatccgcac
ccaaacattcttatgttgcatgaagtggtttttgacagaaaatctggttctcttgcacta
atatgtgaacttatggacatgaatatttatgagctaatacgagggagaagatacccatta
tcagaaaaaaaaattatgcactatatgtaccagttatgtaagtccctggatcatattcac
agaaatggaatatttcacagagatgtaaaaccagaaaatatactaataaagcaggatgtc
ctgaaattaggggactttggctcctgccggagtgtctattccaagcagccgtacacggaa
tacatctccacccgctggtaccgggccccggagtgtctcctcactgatgggttctacacg
tacaagatggacctgtggagcgccggctgtgtgttctacgagatcgccagtctgcagccc
ctctttcctggagtaaatgaactggaccaaatctcaaaaatccacgatgtcatcggcaca
cccgctcagaagatcctcaccaagttcaaacagtcgagagctatgaattttgattttcct
tttaaaaagggatcaggaatacctctactaacaaccaatttgtccccacaatgcctctcc
ctcctgcacgcaatggtggcctatgatcccgatgagagaatcgccgcccaccaggccctg
cagcacccctacttccaagaacagaggaaaacagagaagcgggctctgggcagccacaga
aaagctggctttccggagcaccctgtggcaccggaaccactcagtaacagctgccagatt
tccaaggagggcagaaagcagaaacagtccctaaagcaagaggaggaccgtcccaagaga
cgaggaccggcctatgtcatggaactgcccaaactaaagctttcgggagtggtcagactg
tcgtcttactccagccccacgctgcagtccgtgcttggatctggaacaaatggaagagtg
ccggtgctgagacccttgaagtgcatccctgcgagcaagaagacagatccgcagaaggac
cttaagcctgccccgcagcagtgtcgcctgcccaccatagtgcggaaaggcggaagataa

DBGET integrated database retrieval system