KEGG   Homo sapiens (human): 5898Help
Entry
5898              CDS       T01001                                 

Gene name
RALA, RAL
Definition
(RefSeq) RAS like proto-oncogene A
  KO
K07834  Ras-related protein Ral-A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa05200  Pathways in cancer
hsa05210  Colorectal cancer
hsa05212  Pancreatic cancer
Network
nt06213  Other RAS signaling
nt06260  Colorectal cancer
nt06262  Pancreatic cancer
  Element
N00103  EGF-EGFR-RAS-RalGDS signaling pathway
N00104  Mutation-activated KRAS to RalGDS signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    5898 (RALA)
   04015 Rap1 signaling pathway
    5898 (RALA)
   04072 Phospholipase D signaling pathway
    5898 (RALA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    5898 (RALA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    5898 (RALA)
   05212 Pancreatic cancer
    5898 (RALA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5898 (RALA)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hsa04031]
    5898 (RALA)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Tethering complex
   Exocyst complex assembly proteins
    5898 (RALA)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Ras Family
   Ral
    5898 (RALA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf RsgA_GTPase GTP_EFTU MMR_HSR1 AAA_25 MMR_HSR1_Xtn ThiF
Motif
Other DBs
NCBI-GeneID: 5898
NCBI-ProteinID: NP_005393
OMIM: 179550
HGNC: 9839
Ensembl: ENSG00000006451
Vega: OTTHUMG00000128775
Pharos: P11233(Tbio)
UniProt: P11233
Structure
PDB: 

Position
7p14.1
AA seq 206 aa AA seqDB search
MAANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGE
EVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENV
PFLLVGNKSDLEDKRQVSVEEAKNRAEQWNVNYVETSAKTRANVDKVFFDLMREIRARKM
EDSKEKNGKKKRKSLAKRIRERCCIL
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaaataagcccaagggtcagaattctttggctttacacaaagtcatcatggtg
ggcagtggtggcgtgggcaagtcagctctgactctacagttcatgtacgatgagtttgtg
gaggactatgagcctaccaaagcagacagctatcggaagaaggtagtgctagatggggag
gaagtccagatcgatatcttagatacagctgggcaggaggactacgctgcaattagagac
aactacttccgaagtggggaggggttcctctgtgttttctctattacagaaatggaatcc
tttgcagctacagctgacttcagggagcagattttaagagtaaaagaagatgagaatgtt
ccatttctactggttggtaacaaatcagatttagaagataaaagacaggtttctgtagaa
gaggcaaaaaacagagctgagcagtggaatgttaactacgtggaaacatctgctaaaaca
cgagctaatgttgacaaggtattttttgatttaatgagagaaattcgagcgagaaagatg
gaagacagcaaagaaaagaatggaaaaaagaagaggaaaagtttagccaagagaatcaga
gaaagatgctgcattttataa

KEGG   Homo sapiens (human): 5899Help
Entry
5899              CDS       T01001                                 

Gene name
RALB
Definition
(RefSeq) RAS like proto-oncogene B
  KO
K07835  Ras-related protein Ral-B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa05200  Pathways in cancer
hsa05210  Colorectal cancer
hsa05212  Pancreatic cancer
Network
nt06213  Other RAS signaling
nt06260  Colorectal cancer
nt06262  Pancreatic cancer
  Element
N00103  EGF-EGFR-RAS-RalGDS signaling pathway
N00104  Mutation-activated KRAS to RalGDS signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    5899 (RALB)
   04015 Rap1 signaling pathway
    5899 (RALB)
   04072 Phospholipase D signaling pathway
    5899 (RALB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    5899 (RALB)
  09162 Cancer: specific types
   05210 Colorectal cancer
    5899 (RALB)
   05212 Pancreatic cancer
    5899 (RALB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5899 (RALB)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hsa04031]
    5899 (RALB)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Tethering complex
   Exocyst complex assembly proteins
    5899 (RALB)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Ras Family
   Ral
    5899 (RALB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf RsgA_GTPase SRPRB GTP_EFTU MMR_HSR1 Gtr1_RagA AAA_25 FeoB_N AAA_24
Motif
Other DBs
NCBI-GeneID: 5899
NCBI-ProteinID: NP_002872
OMIM: 179551
HGNC: 9840
Ensembl: ENSG00000144118
Vega: OTTHUMG00000131435
Pharos: P11234(Tbio)
UniProt: P11234 A0A024RAG3
Structure
PDB: 

Position
2q14.2
AA seq 206 aa AA seqDB search
MAANKSKGQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGE
EVQIDILDTAGQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDK
IPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRTKK
MSENKDKNGKKSSKNKKSFKERCCLL
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggctgccaacaagagtaagggccagagctccttggccctccacaaggtgatcatggtt
ggcagcggaggcgttggcaagtcagccctgacgcttcagttcatgtatgacgagtttgta
gaagactatgaacctaccaaagctgacagttatagaaagaaagtggttcttgatggggaa
gaagttcagatagatattctggacaccgctgggcaagaggactacgcagccattcgagat
aactactttcggagtggggaagggtttcttcttgtgttctcaatcacagaacatgaatcc
tttacagcaactgccgaattcagggaacagattctccgtgtgaaggctgaagaagataaa
attccactgctcgtcgtgggaaacaagtctgacctagaggagcggaggcaggtgcctgtg
gaggaggccaggagtaaagccgaagagtggggcgtgcagtacgtggagacgtcagcgaag
acccgggccaacgtggacaaggtgttctttgacctaatgagagaaatcagaacaaagaag
atgtcagaaaacaaagacaagaatggcaagaaaagcagcaagaacaagaaaagttttaaa
gaaagatgttgcttactatga

DBGET integrated database retrieval system