KEGG   Homo sapiens (human): 5905Help
Entry
5905              CDS       T01001                                 

Gene name
RANGAP1, Fug1, RANGAP, SD
Definition
(RefSeq) Ran GTPase activating protein 1
  KO
K14319  Ran GTPase-activating protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
Module
hsa_M00427  Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    5905 (RANGAP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    5905 (RANGAP1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Ran-mediated transport factors
     5905 (RANGAP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RanGAP1_C LRR_6 LRR_8 SDA1 CPSF100_C Nop14 IFN-gamma DUF4471 DUF2052 SpoIIP Mpp10 DUF4820 BUD22 Presenilin THOC2_N DNA_pol_phi RNA_pol_Rpc4 CDC45 PI3K_1B_p101 Tim54 CobT Plasmodium_Vir
Motif
Other DBs
NCBI-GeneID: 5905
NCBI-ProteinID: NP_001265580
OMIM: 602362
HGNC: 9854
Ensembl: ENSG00000100401
Vega: OTTHUMG00000150940
Pharos: P46060(Tbio)
UniProt: P46060 A0A024R1U0 Q9BSK3
Structure
PDB: 

Position
22q13.2
AA seq 587 aa AA seqDB search
MASEDIAKLAETLAKTQVAGGQLSFKGKSLKLNTAEDAKDVIKEIEDFDSLEALRLEGNT
VGVEAARVIAKALEKKSELKRCHWSDMFTGRLRTEIPPALISLGEGLITAGAQLVELDLS
DNAFGPDGVQGFEALLKSSACFTLQELKLNNCGMGIGGGKILAAALTECHRKSSAQGKPL
ALKVFVAGRNRLENDGATALAEAFRVIGTLEEVHMPQNGINHPGITALAQAFAVNPLLRV
INLNDNTFTEKGAVAMAETLKTLRQVEVINFGDCLVRSKGAVAIADAIRGGLPKLKELNL
SFCEIKRDAALAVAEAMADKAELEKLDLNGNTLGEEGCEQLQEVLEGFNMAKVLASLSDD
EDEEEEEEGEEEEEEAEEEEEEDEEEEEEEEEEEEEEPQQRGQGEKSATPSRKILDPNTG
EPAPVLSSPPPADVSTFLAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVF
KDEATVRMAVQDAVDALMQKAFNSSSFNSNTFLTRLLVHMGLLKSEDKVKAIANLYGPLM
ALNHMVQQDYFPKALAPLLLAFVTKPNSALESCSFARHSLLQTLYKV
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atggcctcggaagacattgccaagctggcagagacacttgccaagactcaggtggccggg
ggacagctgagtttcaaaggcaagagcctcaaactcaacactgcagaagatgctaaagat
gtgattaaagagattgaagactttgacagcttggaggctctgcgtctggaaggcaacaca
gtgggcgtggaagcagccagggtcatcgccaaggccttagagaagaagtcggagttgaag
cgctgccactggagtgacatgttcacgggaaggctgcggaccgagatcccaccagccctg
atctcactaggggaaggactcatcacagctggggctcagctggtggagctggacttaagc
gacaacgcattcgggcccgacggtgtgcaaggcttcgaggccctgctcaagagctcagcc
tgcttcaccctgcaggaactcaagctcaacaactgtggcatgggcattggcggcggcaag
atcctggctgcagctctgaccgaatgtcaccggaaatccagtgcccaaggcaagcctctg
gccctgaaggtctttgtggctggcagaaaccgtctggagaatgatggcgccactgccttg
gcagaagcttttagggtcatcgggaccctggaggaggtccacatgccacagaatgggatc
aaccaccctggcatcactgccctggcccaggctttcgctgtcaaccccctgctgcgggtc
atcaacctgaatgacaacaccttcactgagaagggcgccgtggccatggccgagaccttg
aagaccttgcggcaggtggaggtgattaattttggggactgcctggtgcgctccaagggt
gcagttgccattgcagatgccatccgcggcggcctgcccaagctaaaggagctgaacttg
tcattctgtgaaatcaagagggatgctgccctggctgttgctgaggccatggcagacaaa
gctgagctggagaagctggacctgaatggcaacaccctgggagaagaaggctgtgaacag
cttcaggaggtgctggagggcttcaacatggccaaggtgctggcgtccctcagtgatgac
gaggacgaggaggaggaggaggaaggagaagaggaagaagaggaagcagaagaagaggag
gaggaagatgaggaagaggaggaagaagaggaggaggaggaggaagaagagcctcagcag
cgagggcagggagagaagtcagccacgccctcacggaagattctggaccctaacactggg
gagccagctcccgtgctgtcctccccacctcctgcagacgtctccaccttcctggctttt
ccctctccagagaagctgctgcgcctagggcccaagagctccgtgctgatagcccagcag
actgacacgtctgaccccgagaaggtggtctctgccttcctaaaggtgtcatctgtgttc
aaggacgaagctactgtgaggatggcagtgcaggatgcagtagatgccctgatgcagaag
gctttcaactcctcgtccttcaactccaacaccttcctcaccaggctgctcgtgcacatg
ggtctgctcaagagtgaagacaaggtcaaggccattgccaacctgtacggccccctgatg
gcgctgaaccacatggtgcagcaggactatttccccaaggcccttgcacccctgctgctg
gcgttcgtgaccaagcccaacagcgccctggaatcctgctccttcgcccgccacagtctg
ctgcagacgctgtacaaggtctag

DBGET integrated database retrieval system