KEGG   Homo sapiens (human): 59067Help
Entry
59067             CDS       T01001                                 

Gene name
IL21, CVID11, IL-21, Za11
Definition
(RefSeq) interleukin 21
  KO
K05434  interleukin 21
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  Jak-STAT signaling pathway
hsa04659  Th17 cell differentiation
hsa05321  Inflammatory bowel disease (IBD)
Disease
H00408  Type I diabetes mellitus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    59067 (IL21)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    59067 (IL21)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    59067 (IL21)
 09160 Human Diseases
  09162 Immune diseases
   05321 Inflammatiory bowel disease (IBD)
    59067 (IL21)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    59067 (IL21)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interleukins
   59067 (IL21)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL15
Motif
Other DBs
NCBI-GeneID: 59067
NCBI-ProteinID: NP_001193935
OMIM: 605384
HGNC: 6005
Ensembl: ENSG00000138684
Vega: OTTHUMG00000133073
Pharos: Q9HBE4(Tbio)
UniProt: Q9HBE4
Structure
PDB: 

Position
4q27
AA seq 153 aa AA seqDB search
MRSSPGNMERIVICLMVIFLGTLVHKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEF
LPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRL
TCPSCDSYEKKPPKEFLERFKSLLQKVSTLSFI
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgagatccagtcctggcaacatggagaggattgtcatctgtctgatggtcatcttcttg
gggacactggtccacaaatcaagctcccaaggtcaagatcgccacatgattagaatgcgt
caacttatagatattgttgatcagctgaaaaattatgtgaatgacttggtccctgaattt
ctgccagctccagaagatgtagagacaaactgtgagtggtcagctttttcctgctttcag
aaggcccaactaaagtcagcaaatacaggaaacaatgaaaggataatcaatgtatcaatt
aaaaagctgaagaggaaaccaccttccacaaatgcagggagaagacagaaacacagacta
acatgcccttcatgtgattcttatgagaaaaaaccacccaaagaattcctagaaagattc
aaatcacttctccaaaaggtatctaccttaagtttcatttga

DBGET integrated database retrieval system