KEGG   Homo sapiens (human): 59082Help
Entry
59082             CDS       T01001                                 

Gene name
CARD18, ICEBERG, UNQ5804, pseudo-ICE
Definition
(RefSeq) caspase recruitment domain family member 18
  KO
K12806  caspase recruitment domain-containing protein 16/17/18
Organism
hsa  Homo sapiens (human)
Pathway
hsa04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    59082 (CARD18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CARD
Motif
Other DBs
NCBI-GeneID: 59082
NCBI-ProteinID: NP_067546
OMIM: 605354
HGNC: 28861
Ensembl: ENSG00000255501
Vega: OTTHUMG00000166165
Pharos: P57730(Tdark)
UniProt: P57730
Structure
PDB: 

Position
11q22.3
AA seq 90 aa AA seqDB search
MADQLLRKKRRIFIHSVGAGTINALLDCLLEDEVISQEDMNKVRDENDTVMDKARVLIDL
VTGKGPKSCCKFIKHLCEEDPQLASKMGLH
NT seq 273 nt NT seq  +upstreamnt  +downstreamnt
atggctgaccaactcttgcgtaaaaagagaagaatttttatccattcagtgggtgcaggc
acaataaatgccttgctggattgcctattagaggatgaagttattagccaggaagacatg
aacaaagtgagagatgaaaatgacactgtcatggataaggctcgagtcttgattgacctt
gttactggaaaaggacccaagtcttgctgcaaatttatcaagcatctctgtgaagaagac
cctcaacttgcctcaaagatgggtttgcactaa

DBGET integrated database retrieval system