KEGG   Homo sapiens (human): 5914Help
Entry
5914              CDS       T01001                                 

Gene name
RARA, NR1B1, RAR
Definition
(RefSeq) retinoic acid receptor alpha
  KO
K08527  retinoic acid receptor alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04659  Th17 cell differentiation
hsa04915  Estrogen signaling pathway
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05221  Acute myeloid leukemia
Drug target
Acitretin: D02754
Alitretinoin: D02815
Arsenic trioxide: D02106
Etretinate: D00316
Fenretinide: D04162
Isotretinoin (DG00434): D00348 D04636
Retinol (vit A) (DG00123): D00164 D01621 D06543 D08477
Tamibarotene: D01418
Tazarotene: D01132
Tretinoin (DG00433): D00094 D00094 D01516
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    5914 (RARA)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    5914 (RARA)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    5914 (RARA)
   05202 Transcriptional misregulation in cancer
    5914 (RARA)
  09162 Cancers: Specific types
   05221 Acute myeloid leukemia
    5914 (RARA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    5914 (RARA)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:hsa03310]
    5914 (RARA)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    5914 (RARA)
Nuclear receptors [BR:hsa03310]
 1. Thyroid hormone like
  1B. Retinoic acid receptor (RAR)
   5914 (RARA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C4 Hormone_recep
Motif
Other DBs
NCBI-GeneID: 5914
NCBI-ProteinID: NP_000955
OMIM: 180240
HGNC: 9864
Ensembl: ENSG00000131759
Vega: OTTHUMG00000133328
Pharos: P10276(Tclin)
UniProt: P10276 Q6I9R7
Structure
PDB: 

Position
17q21.2
AA seq 462 aa AA seqDB search
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPAT
IETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNM
VYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTL
TPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTV
EFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNA
GFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALK
VYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGL
DTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggccagcaacagcagctcctgcccgacacctgggggcgggcacctcaatgggtacccg
gtgcctccctacgccttcttcttcccccctatgctgggtggactctccccgccaggcgct
ctgaccactctccagcaccagcttccagttagtggatatagcacaccatccccagccacc
attgagacccagagcagcagttctgaagagatagtgcccagccctccctcgccaccccct
ctaccccgcatctacaagccttgctttgtctgtcaggacaagtcctcaggctaccactat
ggggtcagcgcctgtgagggctgcaagggcttcttccgccgcagcatccagaagaacatg
gtgtacacgtgtcaccgggacaagaactgcatcatcaacaaggtgacccggaaccgctgc
cagtactgccgactgcagaagtgctttgaagtgggcatgtccaaggagtctgtgagaaac
gaccgaaacaagaagaagaaggaggtgcccaagcccgagtgctctgagagctacacgctg
acgccggaggtgggggagctcattgagaaggtgcgcaaagcgcaccaggaaaccttccct
gccctctgccagctgggcaaatacactacgaacaacagctcagaacaacgtgtctctctg
gacattgacctctgggacaagttcagtgaactctccaccaagtgcatcattaagactgtg
gagttcgccaagcagctgcccggcttcaccaccctcaccatcgccgaccagatcaccctc
ctcaaggctgcctgcctggacatcctgatcctgcggatctgcacgcggtacacgcccgag
caggacaccatgaccttctcggacgggctgaccctgaaccggacccagatgcacaacgct
ggcttcggccccctcaccgacctggtctttgccttcgccaaccagctgctgcccctggag
atggatgatgcggagacggggctgctcagcgccatctgcctcatctgcggagaccgccag
gacctggagcagccggaccgggtggacatgctgcaggagccgctgctggaggcgctaaag
gtctacgtgcggaagcggaggcccagccgcccccacatgttccccaagatgctaatgaag
attactgacctgcgaagcatcagcgccaagggggctgagcgggtgatcacgctgaagatg
gagatcccgggctccatgccgcctctcatccaggaaatgttggagaactcagagggcctg
gacactctgagcggacagccggggggtggggggcgggacgggggtggcctggcccccccg
ccaggcagctgtagccccagcctcagccccagctccaacagaagcagcccggccacccac
tccccgtga

DBGET integrated database retrieval system