KEGG   Homo sapiens (human): 5915Help
Entry
5915              CDS       T01001                                 

Gene name
RARB, HAP, MCOPS12, NR1B2, RARbeta1, RRB2
Definition
(RefSeq) retinoic acid receptor beta
  KO
K08528  retinoic acid receptor beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa05200  Pathways in cancer
hsa05222  Small cell lung cancer
hsa05223  Non-small cell lung cancer
hsa05226  Gastric cancer
Disease
H00013  Small cell lung cancer
H00014  Non-small cell lung cancer
H00018  Gastric cancer
H01027  Anophthalmia and microphthalmia (A/M)
Drug target
Acitretin: D02754
Adapalene: D01112
Alitretinoin: D02815
Etretinate: D00316
Fenretinide: D04162
Isotretinoin (DG00434): D00348 D04636
Retinol (vit A) (DG00123): D00164 D01621 D06543 D08477
Tazarotene: D01132
Tretinoin (DG00433): D00094 D01516
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    5915 (RARB)
   05226 Gastric cancer
    5915 (RARB)
   05222 Small cell lung cancer
    5915 (RARB)
   05223 Non-small cell lung cancer
    5915 (RARB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    5915 (RARB)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:hsa03310]
    5915 (RARB)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    5915 (RARB)
Nuclear receptors [BR:hsa03310]
 1. Thyroid hormone like
  1B. Retinoic acid receptor (RAR)
   5915 (RARB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C4 Hormone_recep
Motif
Other DBs
NCBI-GeneID: 5915
NCBI-ProteinID: NP_001277145
OMIM: 180220
HGNC: 9865
Ensembl: ENSG00000077092
Vega: OTTHUMG00000130480
Pharos: P10826(Tclin)
UniProt: P10826
Structure
PDB: 

Position
3p24.2
AA seq 455 aa AA seqDB search
MTTSGHACPVPAVNGHMTHYPATPYPLLFPPVIGGLSLPPLHGLHGHPPPSGCSTPSPAT
IETQSTSSEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNM
IYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKETSKQECTESYEM
TAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIV
EFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNA
GFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALK
IYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGH
EPLTPSSSGNTAEHSPSISPSSVENSGVSQSPLVQ
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccagcggccacgcatgtccggtcccagcagtgaacggacacatgactcactat
ccagccacaccctacccgttactctttccacctgtcatcggaggactttccctgcctccc
ctccatggccttcatggacatccgcctccgagtggatgcagcaccccgtcgccggcaaca
attgaaacacagagcaccagctctgaggaactcgtcccaagccccccatctccacttcct
ccccctcgagtgtacaaaccctgcttcgtctgccaggacaaatcatcagggtaccactat
ggggtcagcgcctgtgagggatgtaagggctttttccgcagaagtattcagaagaatatg
atttacacttgtcaccgagataagaactgtgttattaataaagtcaccaggaatcgatgc
caatactgtcgactccagaagtgctttgaagtgggaatgtccaaagaatctgtcaggaat
gacaggaacaagaaaaagaaggagacttcgaagcaagaatgcacagagagctatgaaatg
acagctgagttggacgatctcacagagaagatccgaaaagctcaccaggaaactttccct
tcactctgccagctgggtaaatacaccacgaattccagtgctgaccatcgagtccgactg
gacctgggcctctgggacaaattcagtgaactggccaccaagtgcattattaagatcgtg
gagtttgctaaacgtctgcctggtttcactggcttgaccatcgcagaccaaattaccctg
ctgaaggccgcctgcctggacatcctgattcttagaatttgcaccaggtataccccagaa
caagacaccatgactttctcagacggccttaccctaaatcgaactcagatgcacaatgct
ggatttggtcctctgactgaccttgtgttcacctttgccaaccagctcctgcctttggaa
atggatgacacagaaacaggccttctcagtgccatctgcttaatctgtggagaccgccag
gaccttgaggaaccgacaaaagtagataagctacaagaaccattgctggaagcactaaaa
atttatatcagaaaaagacgacccagcaagcctcacatgtttccaaagatcttaatgaaa
atcacagatctccgtagcatcagtgctaaaggtgcagagcgtgtaattaccttgaaaatg
gaaattcctggatcaatgccacctctcattcaagaaatgctggagaattctgaaggacat
gaacccttgaccccaagttcaagtgggaacacagcagagcacagtcctagcatctcaccc
agctcagtggaaaacagtggggtcagtcagtcaccactcgtgcaataa

DBGET integrated database retrieval system