KEGG   Homo sapiens (human): 5916Help
Entry
5916              CDS       T01001                                 

Gene name
RARG, NR1B3, RARC
Definition
(RefSeq) retinoic acid receptor gamma
  KO
K08529  retinoic acid receptor gamma
Organism
hsa  Homo sapiens (human)
Drug target
Acitretin: D02754
Adapalene: D01112
Alitretinoin: D02815
Etretinate: D00316
Fenretinide: D04162
Isotretinoin (DG00434): D00348 D04636
Palovarotene: D09365
Retinol (vit A) (DG00123): D00164 D01621 D06543 D08477
Tazarotene: D01132
Tretinoin (DG00433): D00094 D01516
Brite
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    5916 (RARG)
Nuclear receptors [BR:hsa03310]
 1. Thyroid hormone like
  1B. Retinoic acid receptor (RAR)
   5916 (RARG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C4 Hormone_recep
Motif
Other DBs
NCBI-GeneID: 5916
NCBI-ProteinID: NP_000957
OMIM: 180190
HGNC: 9866
Ensembl: ENSG00000172819
Vega: OTTHUMG00000048077
Pharos: P13631(Tclin)
UniProt: P13631 A8K3H3
Structure
PDB: 

Position
12q13.13
AA seq 454 aa AA seqDB search
MATNKERLFAAGALGPGSGYPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMAS
LSVETQSTSSEEMVPSSPSPPPPPRVYKPCFVCNDKSSGYHYGVSSCEGCKGFFRRSIQK
NMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKEAVRNDRNKKKKEVKEEGSPDSY
ELSPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIK
IVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMH
NAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEA
LRLYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREMLENPE
MFEDDSSQPGPHPNASSEDEVPGGQGKGGLKSPA
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggccaccaataaggagcgactctttgcggctggtgccctggggcctggatctggctac
ccaggggcaggtttccccttcgccttcccaggggcactcagggggtctccgcctttcgag
atgctgagccctagcttccggggcctgggccagcctgacctccccaaggagatggcctct
ctgtcggtggagacacagagcaccagctcagaggagatggtgcccagctcgccctcgccc
cctccgcctcctcgggtctacaagccatgcttcgtgtgcaatgacaagtcctctggctac
cactatggggtcagctcttgtgaaggctgcaagggcttctttcgccgaagcatccagaag
aacatggtgtacacgtgtcaccgcgacaaaaactgtatcatcaacaaggtgaccaggaat
cgctgccagtactgccggctacagaagtgcttcgaagtgggcatgtccaaggaagctgtg
cgaaatgaccggaacaagaagaagaaagaggtgaaggaagaagggtcacctgacagctat
gagctgagccctcagttagaagagctcatcaccaaggtcagcaaagcccatcaggagact
ttcccctcgctctgccagctgggcaagtataccacgaactccagtgcagaccaccgcgtg
cagctggatctggggctgtgggacaagttcagtgagctggctaccaagtgcatcatcaag
atcgtggagtttgccaagcggttgcctggctttacagggctcagcattgctgaccagatc
actctgctcaaagctgcctgcctagatatcctgatgctgcgtatctgcacaaggtacacc
ccagagcaggacaccatgaccttctccgacgggctgaccctgaaccggacccagatgcac
aatgccggcttcgggcccctcacagaccttgtctttgcctttgctgggcagctcctgccc
ctggagatggatgacaccgagacagggctgctcagcgccatctgcctcatctgcggagac
cgcatggacctggaggagcccgaaaaagtggacaagctgcaggagccactgctggaagcc
ctgaggctgtacgcccggcgccggcggcccagccagccctacatgttcccaaggatgcta
atgaaaatcaccgacctccggggcatcagcactaagggagctgaaagggccattactctg
aagatggagattccaggcccgatgcctcccttaatccgagagatgctggagaaccctgaa
atgtttgaggatgactcctcgcagcctggtccccaccccaatgcctctagcgaggatgag
gttcctgggggccagggcaaagggggcctgaagtccccagcctga

DBGET integrated database retrieval system