KEGG   Homo sapiens (human): 5917
Entry
5917              CDS       T01001                                 

Gene name
RARS1, ArgRS, DALRD1, HLD9, RARS
Definition
(RefSeq) arginyl-tRNA synthetase 1
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00970  Aminoacyl-tRNA biosynthesis
Disease
H00679  Hypomyelinating leukodystrophy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    5917 (RARS1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hsa01007]
    5917 (RARS1)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hsa03016]
    5917 (RARS1)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    5917 (RARS1)
Enzymes [BR:hsa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     5917 (RARS1)
Amino acid related enzymes [BR:hsa01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   5917 (RARS1)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    5917 (RARS1)
 Prokaryotic type
   Other AARSs
    5917 (RARS1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    5917 (RARS1)
SSDB
Motif
Pfam: tRNA-synt_1d DALR_1 Arg_tRNA_synt_N tRNA-synt_1e
Other DBs
NCBI-GeneID: 5917
NCBI-ProteinID: NP_002878
OMIM: 107820
HGNC: 9870
Ensembl: ENSG00000113643
Vega: OTTHUMG00000130411
Pharos: P54136(Tchem)
UniProt: P54136
Structure
PDB: 
4ZAJ 4Q2T 4Q2X 4Q2Y 4R3Z

Position
5q34
AA seq 660 aa
MDVLVSECSARLLQQEEEIKSLTAEIDRLKNCGCLGASPNLEQLQEENLKLKYRLNILRK
SLQAERNKPTKNMINIISRLQEVFGHAIKAAYPDLENPPLLVTPSQQAKFGDYQCNSAMG
ISQMLKTKEQKVNPREIAENITKHLPDNECIEKVEIAGPGFINVHLRKDFVSEQLTSLLV
NGVQLPALGENKKVIVDFSSPNIAKEMHVGHLRSTIIGESISRLFEFAGYDVLRLNHVGD
WGTQFGMLIAHLQDKFPDYLTVSPPIGDLQVFYKESKKRFDTEEEFKKRAYQCVVLLQGK
NPDITKAWKLICDVSRQELNKIYDALDVSLIERGESFYQDRMNDIVKEFEDRGFVQVDDG
RKIVFVPGCSIPLTIVKSDGGYTYDTSDLAAIKQRLFEEKADMIIYVVDNGQSVHFQTIF
AAAQMIGWYDPKVTRVFHAGFGVVLGEDKKKFKTRSGETVRLMDLLGEGLKRSMDKLKEK
ERDKVLTAEELNAAQTSVAYGCIKYADLSHNRLNDYIFSFDKMLDDRGNTAAYLLYAFTR
IRSIARLANIDEEMLQKAARETKILLDHEKEWKLGRCILRFPEILQKILDDLFLHTLCDY
IYELATAFTEFYDSCYCVEKDRQTGKILKVNMWRMLLCEAVAAVMAKGFDILGIKPVQRM
NT seq 1983 nt   +upstreamnt  +downstreamnt
atggacgtactggtgtctgagtgctccgcgcggctgctgcagcaggaagaagagattaaa
tctctgactgctgaaattgaccggttgaaaaactgtggctgtttaggagcttctccaaat
ttggagcagttacaagaagaaaatttaaaattaaagtatcgactgaatattcttcgaaag
agtcttcaggcagaaaggaacaaaccaactaaaaatatgattaacattattagccgccta
caagaggtctttggtcatgcaattaaggctgcatatccagatttggaaaatcctcctctg
ctagtgacaccaagtcagcaggccaagtttggggactatcagtgtaatagtgctatgggt
atttctcagatgctcaaaaccaaggaacagaaagttaatccaagagaaattgctgaaaac
attaccaaacacctcccagacaatgaatgtattgaaaaagttgaaattgctggtcctggt
tttattaatgtccacttaagaaaggattttgtatcagaacaattgaccagtcttctagtg
aatggagttcaactacctgctctgggagagaataaaaaggttatagttgacttttcctcc
cctaatatagctaaagagatgcatgtaggccacctgaggtcaactatcataggagagagt
ataagccgcctctttgaatttgcagggtatgacgtgctcaggttaaatcatgtaggagac
tgggggacccagtttggcatgctcatcgctcacctgcaagacaaatttccagattatcta
acagtttcacctcctattggggatcttcaggtcttttataaggaatctaagaagaggttt
gatactgaggaggaatttaagaagcgagcatatcagtgtgtagttctgctccagggtaaa
aacccagatattacaaaagcttggaagcttatctgtgatgtctcccgccaagagttaaat
aaaatctatgatgcattggacgtctctttaatagagagaggggaatccttctatcaagat
aggatgaatgatattgtaaaggaatttgaagatagaggatttgtgcaggtggatgatggc
agaaagattgtatttgtcccagggtgttccataccattaaccatagtaaaatcagatgga
ggttatacctatgatacatctgacctggctgctattaaacaaagactatttgaggaaaaa
gcagatatgattatctatgttgtggacaatggacaatctgtgcacttccagacaatattt
gctgctgctcaaatgattggttggtatgaccctaaagtaactcgagtcttccatgctgga
tttggtgtggtgctaggggaagacaagaaaaagtttaaaacacgttcgggtgaaacagtg
cgcctcatggatcttctgggagaaggactaaaacgatccatggacaagttgaaggaaaaa
gaaagagacaaggtcttaactgcagaggaattgaatgctgctcagacatccgttgcgtat
ggctgcatcaaatatgctgacctttcccataaccggttgaatgactacatcttctccttt
gacaaaatgctagatgacagaggaaatacagctgcttacttgttgtatgccttcactaga
atcaggtctattgcacgtctggccaatattgatgaagaaatgctccaaaaagctgctcga
gaaaccaagattcttttggatcatgagaaggaatggaaactaggccggtgcattttacgg
ttccctgagattctgcaaaagattttagatgacttatttctccacactctctgtgattat
atatatgagctggcaactgctttcacagagttctatgatagctgctactgtgtggagaaa
gatagacagactggaaaaatattgaaggtgaacatgtggcgtatgctgctatgtgaagca
gtagctgctgtcatggccaaggggtttgatatcctgggaataaaacctgtccaaaggatg
taa

DBGET integrated database retrieval system