KEGG   Homo sapiens (human): 5919Help
Entry
5919              CDS       T01001                                 

Gene name
RARRES2, HP10433, TIG2
Definition
(RefSeq) retinoic acid receptor responder 2
  KO
K10044  retinoic acid receptor responder protein 2
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Cathelicidins
Motif
Other DBs
NCBI-GeneID: 5919
NCBI-ProteinID: NP_002880
OMIM: 601973
HGNC: 9868
Ensembl: ENSG00000106538
Vega: OTTHUMG00000158325
Pharos: Q99969(Tbio)
UniProt: Q99969 A0A090N7U9
Position
7q36.1
AA seq 163 aa AA seqDB search
MRRLLIPLALWLGAVGVGVAELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPF
PAGIFVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIE
TQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFSKALPRS
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgcgacggctgctgatccctctggccctgtggctgggtgcggtgggcgtgggcgtcgcc
gagctcacggaagcccagcgccggggcctgcaggtggccctggaggaatttcacaagcac
ccgcccgtgcagtgggccttccaggagaccagtgtggagagcgccgtggacacgcccttc
ccagctggaatatttgtgaggctggaatttaagctgcagcagacaagctgccggaagagg
gactggaagaaacccgagtgcaaagtcaggcccaatgggaggaaacggaaatgcctggcc
tgcatcaaactgggctctgaggacaaagttctgggccggttggtccactgccccatagag
acccaagttctgcgggaggctgaggagcaccaggagacccagtgcctcagggtgcagcgg
gctggtgaggacccccacagcttctacttccctggacagttcgccttctccaaggccctg
ccccgcagctaa

DBGET integrated database retrieval system