KEGG   Homo sapiens (human): 5920
Entry
5920              CDS       T01001                                 

Gene name
PLAAT4, HRASLS4, HRSL4, PLA1/2-3, PLAAT-4, RARRES3, RIG1, TIG3
Definition
(RefSeq) phospholipase A and acyltransferase 4
  KO
K23266  retinoic acid receptor responder protein 3
Organism
hsa  Homo sapiens (human)
Drug target
Inarigivir soproxil: D11385
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    5920 (PLAAT4)
SSDB
Motif
Pfam: LRAT Calici_PP_N NLPC_P60 Peptidase_C97 DUF3514 DUF577
Other DBs
NCBI-GeneID: 5920
NCBI-ProteinID: NP_004576
OMIM: 605092
HGNC: 9869
Ensembl: ENSG00000133321
Vega: OTTHUMG00000167850
Pharos: Q9UL19(Tbio)
UniProt: Q9UL19
Structure
PDB: 
2MY9 2LKT

Position
11q12.3
AA seq 164 aa
MASPHQEPKPGDLIEIFRLGYEHWALYIGDGYVIHLAPPSEYPGAGSSSVFSVLSNSAEV
KRERLEDVVGGCCYRVNNSLDHEYQPRPVEVIISSAKEMVGQKMKYSIVSRNCEHFVTQL
RYGKSRCKQVEKAKVEVGVATALGILVVAGCSFAIRRYQKKATA
NT seq 495 nt   +upstreamnt  +downstreamnt
atggcttcgccacaccaagagcccaaacctggagacctgattgagattttccgccttggc
tatgagcactgggccctgtatataggagatggctacgtgatccatctggctcctccaagt
gagtaccccggggctggctcctccagtgtcttctcagtcctgagcaacagtgcagaggtg
aaacgggagcgcctggaagatgtggtgggaggctgttgctatcgggtcaacaacagcttg
gaccatgagtaccaaccacggcccgtggaggtgatcatcagttctgcgaaggagatggtt
ggtcagaagatgaagtacagtattgtgagcaggaactgtgagcactttgtcacccagctg
agatatggcaagtcccgctgtaaacaggtggaaaaggccaaggttgaagtcggtgtggcc
acggcgcttggaatcctggttgttgctggatgctcttttgcgattaggagataccaaaaa
aaagcgacagcctga

DBGET integrated database retrieval system