KEGG   Homo sapiens (human): 5927Help
Entry
5927              CDS       T01001                                 

Gene name
KDM5A, RBBP-2, RBBP2, RBP2, JARID1A
Definition
(RefSeq) lysine demethylase 5A
  KO
K11446  histone demethylase JARID1 [EC:1.14.11.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5927 (KDM5A)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    5927 (KDM5A)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.-  
     5927 (KDM5A)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     5927 (KDM5A)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   Histone demethylases
    5927 (KDM5A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLU-1 JmjC PHD ARID JmjN zf-C5HC2 PHD_2
Motif
Other DBs
NCBI-GeneID: 5927
NCBI-ProteinID: NP_001036068
OMIM: 180202
HGNC: 9886
Ensembl: ENSG00000073614
Vega: OTTHUMG00000168055
Pharos: P29375(Tbio)
UniProt: P29375
Structure
PDB: 

Position
12p13.33
AA seq 1690 aa AA seqDB search
MAGVGPGGYAAEFVPPPECPVFEPSWEEFTDPLSFIGRIRPLAEKTGICKIRPPKDWQPP
FACEVKSFRFTPRVQRLNELEAMTRVRLDFLDQLAKFWELQGSTLKIPVVERKILDLYAL
SKIVASKGGFEMVTKEKKWSKVGSRLGYLPGKGTGSLLKSHYERILYPYELFQSGVSLMG
VQMPNLDLKEKVEPEVLSTDTQTSPEPGTRMNILPKRTRRVKTQSESGDVSRNTELKKLQ
IFGAGPKVVGLAMGTKDKEDEVTRRRKVTNRSDAFNMQMRQRKGTLSVNFVDLYVCMFCG
RGNNEDKLLLCDGCDDSYHTFCLIPPLPDVPKGDWRCPKCVAEECSKPREAFGFEQAVRE
YTLQSFGEMADNFKSDYFNMPVHMVPTELVEKEFWRLVSSIEEDVIVEYGADISSKDFGS
GFPVKDGRRKILPEEEEYALSGWNLNNMPVLEQSVLAHINVDISGMKVPWLYVGMCFSSF
CWHIEDHWSYSINYLHWGEPKTWYGVPSHAAEQLEEVMRELAPELFESQPDLLHQLVTIM
NPNVLMEHGVPVYRTNQCAGEFVVTFPRAYHSGFNQGYNFAEAVNFCTADWLPIGRQCVN
HYRRLRRHCVFSHEELIFKMAADPECLDVGLAAMVCKELTLMTEEETRLRESVVQMGVLM
SEEEVFELVPDDERQCSACRTTCFLSALTCSCNPERLVCLYHPTDLCPCPMQKKCLRYRY
PLEDLPSLLYGVKVRAQSYDTWVSRVTEALSANFNHKKDLIELRVMLEDAEDRKYPENDL
FRKLRDAVKEAETCASVAQLLLSKKQKHRQSPDSGRTRTKLTVEELKAFVQQLFSLPCVI
SQARQVKNLLDDVEEFHERAQEAMMDETPDSSKLQMLIDMGSSLYVELPELPRLKQELQQ
ARWLDEVRLTLSDPQQVTLDVMKKLIDSGVGLAPHHAVEKAMAELQELLTVSERWEEKAK
VCLQARPRHSVASLESIVNEAKNIPAFLPNVLSLKEALQKAREWTAKVEAIQSGSNYAYL
EQLESLSAKGRPIPVRLEALPQVESQVAAARAWRERTGRTFLKKNSSHTLLQVLSPRTDI
GVYGSGKNRRKKVKELIEKEKEKDLDLEPLSDLEEGLEETRDTAMVVAVFKEREQKEIEA
MHSLRAANLAKMTMVDRIEEVKFCICRKTASGFMLQCELCKDWFHNSCVPLPKSSSQKKG
SSWQAKEVKFLCPLCMRSRRPRLETILSLLVSLQKLPVRLPEGEALQCLTERAMSWQDRA
RQALATDELSSALAKLSVLSQRMVEQAAREKTEKIISAELQKAAANPDLQGHLPSFQQSA
FNRVVSSVSSSPRQTMDYDDEETDSDEDIRETYGYDMKDTASVKSSSSLEPNLFCDEEIP
IKSEEVVTHMWTAPSFCAEHAYSSASKSCSQGSSTPRKQPRKSPLVPRSLEPPVLELSPG
AKAQLEELMMVGDLLEVSLDETQHIWRILQATHPPSEDRFLHIMEDDSMEEKPLKVKGKD
SSEKKRKRKLEKVEQLFGEGKQKSKELKKMDKPRKKKLKLGADKSKELNKLAKKLAKEEE
RKKKKEKAAAAKVELVKESTEKKREKKVLDIPSKYDWSGAEESDDENAVCAAQNCQRPCK
DKVDWVQCDGGCDEWFHQVCVGVSPEMAENEDYICINCAKKQGPVSPGPAPPPSFIMSYK
LPMEDLKETS
NT seq 5073 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgtggggccggggggctacgcggcggagttcgtgccaccgccagagtgcccc
gtctttgagccgagttgggaggagttcacagatccgctcagctttatcggccgcatccgg
cctttggcggagaaaaccggcatctgcaaaattcggccgcccaaggactggcagcctcca
tttgcctgtgaagtaaaaagctttcgtttcactccaagagtccagcgcctgaatgaactt
gaggcaatgaccagagtgagattggatttcttggatcaactagcaaaattttgggaactt
caaggatctactctgaagatccctgtggtagagagaaaaatcctggatctgtatgctttg
agcaagattgttgccagcaaaggaggttttgaaatggtcaccaaagagaagaaatggtct
aaagtgggtagtcgcttgggatatctgccaggaaaaggaactgggtctcttttgaagtca
cattatgaaagaattctctacccatatgagcttttccagtctggtgtgagccttatgggt
gtgcagatgcctaatttagatcttaaagaaaaagtggagcctgaggttctcagcactgat
acccaaacttccccagagccaggcacaaggatgaacattctgccgaagagaacaagacgt
gtgaagactcagtcagaatctggagatgtgagtagaaacacggaactgaagaaacttcag
atttttggggctgggcccaaggttgtgggcttggcaatgggaacaaaagataaagaagat
gaggtcacccgaagacgaaaagttaccaacaggtcagacgcatttaacatgcaaatgaga
caacggaaaggcactctctctgttaactttgttgatctctatgtttgtatgttttgtggt
cggggaaacaatgaagataaattgcttttgtgtgatggatgtgatgacagctatcataca
ttttgtctaattcctccactacctgatgtgcccaaaggagactggaggtgtcctaaatgt
gtcgccgaggaatgtagcaaacctcgagaagcctttggatttgaacaagctgtacgagag
tatacacttcagagctttggagagatggcagataattttaagtctgattattttaatatg
ccagtccatatggttcccacagaactagtagaaaaggaattttggcggctggtaagcagc
attgaagaagatgttattgtggaatatggagcagatatctcctcaaaagactttggaagt
ggatttccggtgaaggatgggcggagaaagattctgccagaagaagaggaatatgcactt
tctggttggaatttgaataacatgcctgtcctggaacagtctgttcttgcacatattaat
gtggacatctctggtatgaaagtgccgtggctctatgtgggaatgtgcttctcttctttt
tgctggcacattgaggatcactggagttattccatcaactacttgcactggggggagcca
aagacatggtatggtgtgccatctcatgctgcagagcaactggaggaggtgatgagagag
ctggcccccgagttatttgaatcccagcctgatcttctgcatcagttagttaccatcatg
aaccccaacgtgctaatggagcatggtgtgcctgtgtacaggaccaatcagtgtgctggc
gagtttgttgtgacatttcctcgtgcctatcactctggatttaaccagggctacaacttt
gctgaagctgtgaacttctgtactgctgactggttgcccattggacgtcaatgtgtaaat
cattaccgacgcctaaggcgccactgtgtcttttcacacgaggaactaattttcaagatg
gcagcagatccagaatgcttagatgtggggctggctgccatggtctgcaaagaattgact
ctcatgactgaagaagaaacacgattaagagagtctgttgtacagatgggtgtcctgatg
tcagaagaagaagtgtttgaacttgttcctgatgatgagcggcagtgttcagcatgcaga
accacatgttttctctctgctctcacatgttcctgtaatcctgagcggcttgtatgtctc
taccatccaactgatctgtgcccctgccccatgcagaagaaatgtcttagatatcgctac
ccattagaagacctcccttctctgctatatggtgtaaaagtcagggcacagtcctatgac
acttgggtcagtcgtgttacagaagcattgtctgctaacttcaaccacaaaaaagatttg
attgaattgcgagtaatgctggaagatgctgaggataggaaatacccagagaatgatctc
tttcgaaaactcagggatgctgtaaaagaagctgagacctgtgcttctgtggctcagctg
cttctgagcaaaaagcagaaacacagacagagcccagatagtgggaggactcggaccaaa
ctgacagtggaagaattgaaggcctttgtccaacaactttttagtcttccgtgtgtcatc
agccaagctcggcaagtaaagaatctgctagatgatgtggaagagtttcatgaacgtgct
caggaggccatgatggatgaaaccccagattcttccaaactccagatgttgatagatatg
ggctctagtctctatgtggaactccctgaattaccacgactgaagcaagagctacaacag
gctcggtggttggacgaagtaagactgaccttatcagatccgcaacaagtcactttggat
gtcatgaagaagctgatagactctggggtagggttggcaccccaccatgctgtggagaaa
gcaatggctgaactacaggagctccttacagtctctgaacgatgggaagaaaaggctaag
gtctgcctacaggcaagaccgaggcacagtgtggcaagtttagaaagcattgtgaatgaa
gccaagaacattccagcctttctacccaatgtgttgtccttgaaagaagccttacaaaag
gctcgagaatggaccgctaaagtggaagctattcagagtggcagcaattacgcttatttg
gagcagcttgagagcttgtctgcgaaaggacgccctattcctgtgcgtcttgaagcactg
ccgcaagtggaatcacaggtagcagcagcacgggcatggagagaacggactgggcggacg
tttcttaagaagaattctagccatacattgttacaggtgctgagcccccggaccgacatt
ggtgtatatgggagtggcaaaaataggaggaaaaaagtaaaagaactaatagaaaaagaa
aaagaaaaggatctggacctggagcctctgagtgatctggaggaaggattggaggaaacc
agagatacagccatggtggtggcagttttcaaagaacgggagcaaaaagagattgaagcc
atgcattctctcagagcagccaacctagccaagatgacaatggtggaccgcatagaagaa
gtaaaattttgcatttgccgcaagacagccagtgggtttatgctacagtgtgagctctgc
aaagactggttccataacagctgtgttcctcttcctaaatcaagttcccaaaaaaaagga
tccagctggcaagctaaagaagtaaaattcctttgccctctttgtatgcggtctcgaagg
cccaggctagagactattctgtcactcctggtatcccttcagaagttgcccgtacggttg
cctgaaggagaggccctgcagtgtttgacagaacgtgctatgagttggcaagatagagcg
cggcaggctctagccacagatgaactatcctctgccctggccaaactatctgtgttgagc
cagcgtatggtggaacaggcggctcgagaaaaaactgaaaagatcatcagtgcagaactc
caaaaagcagctgccaatccagacttacagggacacttacctagtttccagcagtctgct
tttaaccgggtggtgagcagtgtgtcatcttctcctcgacaaacaatggactatgatgat
gaagaaacagactctgatgaagacattcgagagacatatggctacgacatgaaggacaca
gccagtgtgaagtcctctagtagtcttgaacccaatcttttttgtgatgaagagattccc
atcaaatccgaggaggtggtgacccacatgtggacagcaccttcattttgtgcagagcat
gcttattcttctgcttctaagagttgttctcaaggttctagcaccccaaggaaacaacct
cggaagagccctttggtgccccgaagtttggaacctccagtgctggagttgtcacctgga
gctaaggcacaactggaagaacttatgatggttggagatctcctggaagtatctctggac
gagactcaacacatatggcggattttgcaggccacacacccaccctctgaagacagattc
ttgcatatcatggaggatgacagcatggaagagaaaccactaaaagtgaaaggaaaggac
tcttcagagaagaaacggaaacggaagctagaaaaggtagagcaactttttggagaagga
aaacagaagtccaaggagttaaagaaaatggacaaacctagaaagaagaaattaaaatta
ggtgcagacaaatcaaaggagctgaataaactggccaagaaactagcaaaagaagaagag
agaaagaaaaagaaggagaaggctgctgcagccaaagttgaacttgtgaaagagagcact
gaaaagaaaagagagaaaaaggtgctggacatcccctcaaagtatgactggtcaggagca
gaggagtctgatgatgagaatgctgtgtgcgcagcacagaactgccaaaggccctgcaag
gacaaggtagactgggtacaatgtgatggtggctgtgatgagtggtttcatcaagtttgt
gtgggtgtatctccagaaatggctgaaaatgaagattacatctgtataaactgtgcaaag
aagcaggggccagttagcccaggtccagcaccacctccttccttcataatgagctacaaa
ctaccaatggaggatcttaaagagaccagttag

DBGET integrated database retrieval system