KEGG   Homo sapiens (human): 5928Help
Entry
5928              CDS       T01001                                 

Gene name
RBBP4, NURF55, RBAP48, lin-53
Definition
(RefSeq) RB binding protein 4, chromatin remodeling factor
  KO
K10752  histone-binding protein RBBP4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    5928 (RBBP4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    5928 (RBBP4)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histone chaperones
    CAF-1
     5928 (RBBP4)
  Histone modification proteins
   HAT complexes
    HATB complex
     5928 (RBBP4)
   HDAC complexes
    Sin3A-HDAC complex
     5928 (RBBP4)
   Polycomb group proteins
    PRC2-EZH1 complex
     5928 (RBBP4)
    PRC2-EZH2 complex
     5928 (RBBP4)
  Centromeric chromatin formation proteins
   Kinetochore proteins
    MIS16-MIS18 complex
     5928 (RBBP4)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    5928 (RBBP4)
  Chromatin remodeling factors
   NuRD complex
    5928 (RBBP4)
   NuRF complex
    5928 (RBBP4)
   NuRF complex (fruit fly)
    5928 (RBBP4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CAF1C_H4-bd WD40 ANAPC4_WD40 eIF2A Capsid_NCLDV
Motif
Other DBs
NCBI-GeneID: 5928
NCBI-ProteinID: NP_005601
OMIM: 602923
HGNC: 9887
Ensembl: ENSG00000162521
Vega: OTTHUMG00000007998
Pharos: Q09028(Tbio)
UniProt: Q09028
Structure
PDB: 

Position
1p35.1
AA seq 425 aa AA seqDB search
MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKD
FSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIK
INHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEG
YGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHE
SLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVAL
WDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAE
DGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDP
EGQGS
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggccgacaaggaagcagccttcgacgacgcagtggaagaacgagtgatcaacgaggaa
tacaaaatatggaaaaagaacaccccttttctttatgatttggtgatgacccatgctctg
gagtggcccagcctaactgcccagtggcttccagatgtaaccagaccagaagggaaagat
ttcagcattcatcgacttgtcctggggacacacacatcggatgaacaaaaccatcttgtt
atagccagtgtgcagctccctaatgatgatgctcagtttgatgcgtcacactacgacagt
gagaaaggagaatttggaggttttggttcagttagtggaaaaattgaaatagaaatcaag
atcaaccatgaaggagaagtaaacagggcccgttatatgccccagaacccttgtatcatc
gcaacaaagactccttccagtgatgttcttgtttttgactatacaaaacatccttctaaa
ccagatccttctggagagtgcaacccagacttgcgtctccgtggacatcagaaggaaggc
tatgggctttcttggaacccaaatctcagtgggcacttacttagtgcttcagatgaccat
accatctgcctgtgggacatcagtgccgttccaaaggagggaaaagtggtagatgcgaag
accatctttacagggcatacggcagtagtagaagatgtttcctggcatctactccatgag
tctctgtttgggtcagttgctgatgatcagaaacttatgatttgggatactcgttcaaac
aatacttccaaaccaagccactcagttgatgctcacactgctgaagtgaactgcctttct
ttcaatccttatagtgagttcattcttgccacaggatcagctgacaagactgttgccttg
tgggatctgagaaatctgaaacttaagttgcattcctttgagtcacataaggatgaaata
ttccaggttcagtggtcacctcacaatgagactattttagcttccagtggtactgatcgc
agactgaatgtctgggatttaagtaaaattggagaggaacaatccccagaagatgcagaa
gacgggccaccagagttgttgtttattcatggtggtcatactgccaagatatctgatttc
tcctggaatcccaatgaaccttgggtgatttgttctgtatcagaagacaatatcatgcaa
gtgtggcaaatggcagagaacatttataatgatgaagaccctgaaggaagcgtggatcca
gaaggacaagggtcctag

DBGET integrated database retrieval system