KEGG   Homo sapiens (human): 59284Help
Entry
59284             CDS       T01001                                 

Gene name
CACNG7
Definition
(RefSeq) calcium voltage-gated channel auxiliary subunit gamma 7
  KO
K04872  voltage-dependent calcium channel gamma-7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04260  Cardiac muscle contraction
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04921  Oxytocin signaling pathway
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
hsa05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    59284 (CACNG7)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    59284 (CACNG7)
  Circulatory system
   04260 Cardiac muscle contraction
    59284 (CACNG7)
   04261 Adrenergic signaling in cardiomyocytes
    59284 (CACNG7)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    59284 (CACNG7)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    59284 (CACNG7)
   05414 Dilated cardiomyopathy (DCM)
    59284 (CACNG7)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated
   59284 (CACNG7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Claudin_2 PMP22_Claudin Amastin Claudin_3 DUF716 L_HMGIC_fpl
Motif
Other DBs
NCBI-GeneID: 59284
NCBI-ProteinID: NP_114102
OMIM: 606899
HGNC: 13626
Ensembl: ENSG00000105605
Vega: OTTHUMG00000064852
Pharos: P62955(Tdark)
UniProt: P62955
Position
19q13.42
AA seq 275 aa AA seqDB search
MSHCSSRALTLLSSVFGACGLLLVGIAVSTDYWLYMEEGTVLPQNQTTEVKMALHAGLWR
VCFFAGREKGRCVASEYFLEPEINLVTENTENILKTVRTATPFPMVSLFLVFTAFVISNI
GHIRPQRTILAFVSGIFFILSGLSLVVGLVLYISSINDEVMNRPSSSEQYFHYRYGWSFA
FAASSFLLKEGAGVMSVYLFTKRYAEEEMYRPHPAFYRPRLSDCSDYSGQFLQPEAWRRG
RSPSDISSDVSIQMTQNYPPAIKYPDHLHISTSPC
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgagtcactgcagcagccgcgccctgaccctgctgagcagcgtgtttggtgcgtgtggc
ctgctcctggtaggcatcgcggtcagcactgactactggctgtacatggaagaaggcaca
gtgctaccgcagaaccagaccaccgaggtcaagatggccctgcacgccggcctctggcga
gtctgcttctttgcaggtcgggagaaaggtcgctgtgtggcctcagaatattttcttgaa
ccggagatcaatttggtgacggaaaacacggagaatattctgaagacagtgcgcacggcc
acccccttccccatggtcagcctcttcctcgtgttcacggccttcgtcatcagcaacatc
ggccacatccgcccgcagaggaccattctggcttttgtctctggcatcttcttcatacta
tcgggcctctccttggtggtgggcttggttctttacatctccagcatcaacgacgaggtc
atgaacaggcccagcagctctgagcagtattttcattatcgctacgggtggtcttttgcc
ttcgccgcttcctccttcctactcaaagagggggccggcgtgatgtccgtgtacctgttc
accaagcgctacgcggaggaggagatgtaccgtccacacccggccttctaccgcccgcgt
ctcagcgactgctccgactactcgggccagttcctgcagcccgaggcgtggcgccgcggc
cggagcccctccgacatctccagcgacgtgtccatccaaatgacgcagaactaccctccc
gccatcaagtacccggaccacctgcacatctccacctcgccctgctga

DBGET integrated database retrieval system