KEGG   Homo sapiens (human): 5930
Entry
5930              CDS       T01001                                 
Symbol
RBBP6, MY038, P2P-R, PACT, RBQ-1, SNAMA
Name
(RefSeq) RB binding protein 6, ubiquitin ligase
  KO
K10624  E3 ubiquitin-protein ligase RBBP6 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    5930 (RBBP6)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     5930 (RBBP6)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  U-box type E3
   5930 (RBBP6)
SSDB
Motif
Pfam: DWNN zf-CCHC_2 U-box zf-C3HC4_2 zf-C3HC4_3 zf-CCHC zf-RING_2 zf-RING_5 zf-RING_UBOX zf-C3HC4
Other DBs
NCBI-GeneID: 5930
NCBI-ProteinID: NP_008841
OMIM: 600938
HGNC: 9889
Ensembl: ENSG00000122257
Pharos: Q7Z6E9(Tbio)
UniProt: Q7Z6E9
Structure
Position
16:24539566..24572863
AA seq 1792 aa
MSCVHYKFSSKLNYDTVTFDGLHISLCDLKKQIMGREKLKAADCDLQITNAQTKEEYTDD
NALIPKNSSVIVRRIPIGGVKSTSKTYVISRTEPAMATTKAIDDSSASISLAQLTKTANL
AEANASEEDKIKAMMSQSGHEYDPINYMKKPLGPPPPSYTCFRCGKPGHYIKNCPTNGDK
NFESGPRIKKSTGIPRSFMMEVKDPNMKGAMLTNTGKYAIPTIDAEAYAIGKKEKPPFLP
EEPSSSSEEDDPIPDELLCLICKDIMTDAVVIPCCGNSYCDECIRTALLESDEHTCPTCH
QNDVSPDALIANKFLRQAVNNFKNETGYTKRLRKQLPPPPPPIPPPRPLIQRNLQPLMRS
PISRQQDPLMIPVTSSSTHPAPSISSLTSNQSSLAPPVSGNPSSAPAPVPDITATVSISV
HSEKSDGPFRDSDNKILPAAALASEHSKGTSSIAITALMEEKGYQVPVLGTPSLLGQSLL
HGQLIPTTGPVRINTARPGGGRPGWEHSNKLGYLVSPPQQIRRGERSCYRSINRGRHHSE
RSQRTQGPSLPATPVFVPVPPPPLYPPPPHTLPLPPGVPPPQFSPQFPPGQPPPAGYSVP
PPGFPPAPANLSTPWVSSGVQTAHSNTIPTTQAPPLSREEFYREQRRLKEEEKKKSKLDE
FTNDFAKELMEYKKIQKERRRSFSRSKSPYSGSSYSRSSYTYSKSRSGSTRSRSYSRSFS
RSHSRSYSRSPPYPRRGRGKSRNYRSRSRSHGYHRSRSRSPPYRRYHSRSRSPQAFRGQS
PNKRNVPQGETEREYFNRYREVPPPYDMKAYYGRSVDFRDPFEKERYREWERKYREWYEK
YYKGYAAGAQPRPSANRENFSPERFLPLNIRNSPFTRGRREDYVGGQSHRSRNIGSNYPE
KLSARDGHNQKDNTKSKEKESENAPGDGKGNKHKKHRKRRKGEESEGFLNPELLETSRKS
REPTGVEENKTDSLFVLPSRDDATPVRDEPMDAESITFKSVSEKDKRERDKPKAKGDKTK
RKNDGSAVSKKENIVKPAKGPQEKVDGERERSPRSEPPIKKAKEETPKTDNTKSSSSSQK
DEKITGTPRKAHSKSAKEHQETKPVKEEKVKKDYSKDVKSEKLTTKEEKAKKPNEKNKPL
DNKGEKRKRKTEEKGVDKDFESSSMKISKLEVTEIVKPSPKRKMEPDTEKMDRTPEKDKI
SLSAPAKKIKLNRETGKKIGSTENISNTKEPSEKLESTSSKVKQEKVKGKVRRKVTGTEG
SSSTLVDYTSTSSTGGSPVRKSEEKTDTKRTVIKTMEEYNNDNTAPAEDVIIMIQVPQSK
WDKDDFESEEEDVKSTQPISSVGKPASVIKNVSTKPSNIVKYPEKESEPSEKIQKFTKDV
SHEIIQHEVKSSKNSASSEKGKTKDRDYSVLEKENPEKRKNSTQPEKESNLDRLNEQGNF
KSLSQSSKEARTSDKHDSTRASSNKDFTPNRDKKTDYDTREYSSSKRRDEKNELTRRKDS
PSRNKDSASGQKNKPREERDLPKKGTGDSKKSNSSPSRDRKPHDHKATYDTKRPNEETKS
VDKNPCKDREKHVLEARNNKESSGNKLLYILNPPETQVEKEQITGQIDKSTVKPKPQLSH
SSRLSSDLTRETDEAAFEPDYNESDSESNVSVKEEESSGNISKDLKDKIVEKAKESLDTA
AVVQVGISRNQSHSSPSVSPSRSHSPSGSQTRSHSSSASSAESQDSKKKKKKKEKKKHKK
HKKHKKHKKHAGTEVELEKSQKHKHKKKKSKKNKDKEKEKEKDDQKVKSVTV
NT seq 5379 nt   +upstreamnt  +downstreamnt
atgtcctgtgtgcattataaattttcctctaaactcaactatgataccgtcacctttgat
gggctccacatctccctctgcgacttaaagaagcagattatggggagagagaagctgaaa
gctgccgactgcgacctgcagatcaccaatgcgcagacgaaagaagaatatactgatgat
aatgctctgattcctaagaattcttctgtaattgttagaagaattcctattggaggtgtt
aaatctacaagcaagacatatgttataagtcgaactgaaccagcgatggcaactacaaaa
gcaattgatgactcttccgcgtctatttctctggcccagcttacaaagactgccaatctg
gctgaagccaatgcttctgaagaagataaaattaaagcaatgatgtcgcaatctggccat
gaatacgacccaatcaattacatgaagaaacctctaggtccaccacctccatcttacacg
tgtttccgttgtggtaaacctggacattatattaagaattgcccaacaaatggggataaa
aactttgaatctggtcctaggattaaaaagagcactggaattcccagaagtttcatgatg
gaagtgaaagatcctaatatgaaaggtgcaatgcttaccaacactggaaaatatgcaata
ccaactatagatgcagaagcatatgcaattgggaagaaagagaaacctcccttcttacca
gaggagccatcttcttcctcagaagaagatgatcctatcccagatgaattgttgtgtctc
atctgcaaggatattatgactgatgctgttgtgattccctgctgtggaaacagttactgt
gatgaatgtataagaacagcactcctggaatcagatgagcacacatgtccgacgtgtcat
caaaatgatgtttctcctgatgctttaattgccaataaatttttacgacaggctgtaaat
aacttcaaaaatgaaactggctatacaaaaagactacgaaaacagttacctcctccacca
cccccaataccacctccgagaccactgattcagaggaacctacaacctctgatgagatct
ccgatatcaagacaacaagatcctcttatgattccagtgacatcttcatcaactcaccca
gctccgtctatatcttcattaacttctaatcagtcttccttggcccctcctgtgtctgga
aatccgtcttctgctccagctcctgtacctgatataactgcaacagtatccatatcagtt
cattcagaaaaatcagatggaccttttcgggattctgataataaaatattgccagctgca
gctcttgcatcagagcactcaaagggaacctcctcaattgcaattaccgctcttatggaa
gagaagggttaccaggtgcctgttcttggaaccccatctttgcttggacagtcattattg
catggacagttgatccccacaactggtccagtaagaataaatactgctcgtccaggtggt
ggtcgaccaggctgggaacattccaacaaacttggctatctggtttctccaccacaacaa
attagaagaggggagaggagctgctacagaagtataaaccgtgggcgacaccacagcgaa
agatcacagaggactcaaggcccgtcactaccagcaactccagtctttgtacctgttcca
ccacctcctttgtatccgcctcctccccatacacttcctctccctccgggtgttcctcct
ccacagttttctcctcagtttcctcctggccagccaccacccgctgggtatagtgtccct
cctccagggtttcctccagctcctgccaatttatcaacaccttgggtatcatcaggagtg
cagacagctcattcaaataccatcccaacaacacaagcaccacctttgtccagggaagaa
ttctatagagagcagcgacgactaaaagaagaggaaaagaaaaagtccaagctagatgag
tttacaaatgattttgctaaggaattgatggaatacaaaaagattcaaaaggagcgtagg
cgctcattttccaggtctaaatctccctatagtggttcttcgtattcaagaagttcatat
acttattctaaatcaagatctggttcaacacgttcacgctcttattctcgatcattcagc
cgctcacattctcgttcctattcacggtcacctccataccccagaagaggcagaggcaag
agccgcaattaccgttcacggtctagatctcatggatatcatcgatctaggtcaaggtca
cccccttacagacgctatcattcacgatcaagatctcctcaagcgtttaggggacagtct
cctaataaacgtaatgtacctcaaggggaaacagaacgtgaatattttaatagatacaga
gaagttccaccaccatatgacatgaaagcatattatgggagaagtgttgactttagagac
ccatttgaaaaagaacgctaccgagaatgggagagaaaatatagagagtggtatgaaaaa
tattataaaggttatgctgctggagcacagcctagaccctcagcaaatagagagaacttt
tctccagagagatttttgccacttaacatcaggaattctcccttcacaagaggccgcaga
gaagactatgttggtgggcaaagtcatagaagtcgaaacataggtagcaactatccagaa
aagctttcagcaagagatggtcacaatcagaaggataatacaaagtcaaaagagaaggag
agtgaaaacgctccaggagatggtaaaggaaataagcataagaaacacagaaaaagaaga
aaaggggaggaaagtgagggttttctgaacccagagttattagagacttctaggaaatca
agagaacctacaggtgttgaagaaaataaaacagactcattgtttgttctcccaagtaga
gatgatgccacacctgttagagatgaaccaatggatgcagaatcaatcacttttaaatca
gtgtctgaaaaagacaagagagaaagggataaaccaaaagcaaagggtgataaaaccaaa
cggaagaatgatggatctgctgtgtccaaaaaagaaaatattgtaaaacctgctaaagga
ccccaagaaaaagtagatggagaacgtgagagatctcctcgatctgaacctccaattaaa
aaagccaaagaggagactccgaagactgacaatactaaatcatcatcttcctctcagaag
gatgaaaaaatcactggaacccccagaaaagctcactctaaatcagcaaaagaacaccaa
gaaacaaaaccagtcaaagaggaaaaagtgaagaaggactattccaaagatgtcaaatca
gaaaagctaacaactaaggaagaaaaggccaagaagcctaatgagaaaaacaaaccactt
gataataagggagaaaaaagaaaaagaaaaactgaagaaaaaggcgtagataaagatttt
gagtcttcttcaatgaaaatctcgaaactagaagtgactgaaatagtgaaaccatcacca
aagcgcaaaatggaacctgatactgaaaaaatggataggacccctgaaaaggacaaaatt
tctttaagtgcgccagccaaaaaaatcaaactcaacagagaaactgggaagaaaattgga
agtacagaaaatatatcaaacacaaaagaaccctctgaaaaattggagtcaacatctagc
aaagttaaacaagaaaaagtcaaaggaaaggtcagacgaaaagtgactggaactgaagga
tccagctcaactctggtggattacaccagtacgagctcaactggaggcagtcctgtgcgg
aaatctgaagaaaaaacagatacaaagcgaactgtgattaaaacgatggaagaatataat
aatgacaataccgcgccagctgaagatgttatcattatgattcaggttcctcaatccaaa
tgggataaagatgactttgaatctgaagaagaagatgttaaatccacacagcctatatca
agtgtaggaaaacctgctagtgttataaaaaatgttagtacaaagccatcaaatatagtc
aagtatcctgagaaagaaagtgagccatccgagaaaattcagaaattcaccaaggacgtg
agccatgaaatcatacaacatgaggttaaaagttcaaaaaactctgcatctagtgaaaaa
gggaaaaccaaagatcgagattattcagtgttggaaaaggagaaccctgaaaagaggaag
aacagcactcagccagagaaagagagtaatttggaccgtctgaatgaacaaggaaatttt
aaaagtctgtctcaatcttccaaagaggctagaacgtcagataaacatgattccactcgt
gcttcctcaaataaagacttcactcccaatagagacaaaaaaactgactatgacaccaga
gagtattcaagttccaaacgtagagatgaaaagaatgaattaacaagacgaaaagactct
ccttctcggaataaagattctgcatctggacagaaaaataaaccaagggaagagagagat
ttgcctaaaaaaggaacaggagattccaaaaaaagtaattctagtccctcaagagacaga
aaacctcatgatcacaaagccacttatgatactaaacggccaaatgaagagacaaaatct
gtagataaaaatccttgtaaggatcgtgagaagcatgtattagaagcaaggaacaataaa
gagtcaagtggcaataaactactttatatacttaacccaccagagacacaggttgaaaaa
gagcaaattactgggcaaattgacaagagtactgtcaagcctaaaccccagttaagtcat
tcctctagactttcctctgacttaactagagaaactgatgaagctgcttttgaaccagac
tataatgaaagtgacagtgaaagtaatgtttctgtaaaagaagaggaatcttcaggaaac
atttctaaggacctgaaagataaaatagtggagaaagcaaaagagagcctggacacagca
gcagttgtccaggtgggcataagcaggaatcagagccacagcagccccagcgtcagcccc
agcagaagccacagtccttctggaagccagacccgaagccacagtagcagtgccagctca
gcagaaagtcaggacagcaagaagaagaagaaaaagaaggaaaagaaaaaacacaagaaa
cataaaaagcataagaagcataagaaacatgcaggcactgaagtggaattggaaaaaagc
caaaaacacaaacacaagaaaaagaagtcaaagaagaacaaagataaagagaaggagaag
gagaaagatgaccaaaaagtgaaatctgtcactgtgtaa

DBGET integrated database retrieval system