KEGG   Homo sapiens (human): 5932Help
Entry
5932              CDS       T01001                                 

Gene name
RBBP8, COM1, CTIP, JWDS, RIM, SAE2, SCKL2
Definition
(RefSeq) RB binding protein 8, endonuclease
  KO
K20773  DNA endonuclease RBBP8 [EC:3.1.-.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03440  Homologous recombination
Disease
H00992  Seckel syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    5932 (RBBP8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    5932 (RBBP8)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     5932 (RBBP8)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA1-C complex
     5932 (RBBP8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CtIP_N SAE2
Motif
Other DBs
NCBI-GeneID: 5932
NCBI-ProteinID: NP_002885
OMIM: 604124
HGNC: 9891
Ensembl: ENSG00000101773
Vega: OTTHUMG00000131769
Pharos: Q99708(Tbio)
UniProt: Q99708 A0A024RC34
Structure
PDB: 

Position
18q11.2
AA seq 897 aa AA seqDB search
MNISGSSCGSPNSADTSSDFKDLWTKLKECHDREVQGLQVKVTKLKQERILDAQRLEEFF
TKNQQLREQQKVLHETIKVLEDRLRAGLCDRCAVTEEHMRKKQQEFENIRQQNLKLITEL
MNERNTLQEENKKLSEQLQQKIENDQQHQAAELECEEDVIPDSPITAFSFSGVNRLRRKE
NPHVRYIEQTHTKLEHSVCANEMRKVSKSSTHPQHNPNENEILVADTYDQSQSPMAKAHG
TSSYTPDKSSFNLATVVAETLGLGVQEESETQGPMSPLGDELYHCLEGNHKKQPFEESTR
NTEDSLRFSDSTSKTPPQEELPTRVSSPVFGATSSIKSGLDLNTSLSPSLLQPGKKKHLK
TLPFSNTCISRLEKTRSKSEDSALFTHHSLGSEVNKIIIQSSNKQILINKNISESLGEQN
RTEYGKDSNTDKHLEPLKSLGGRTSKRKKTEEESEHEVSCPQASFDKENAFPFPMDNQFS
MNGDCVMDKPLDLSDRFSAIQRQEKSQGSETSKNKFRQVTLYEALKTIPKGFSSSRKASD
GNCTLPKDSPGEPCSQECIILQPLNKCSPDNKPSLQIKEENAVFKIPLRPRESLETENVL
DDIKSAGSHEPIKIQTRSDHGGCELASVLQLNPCRTGKIKSLQNNQDVSFENIQWSIDPG
ADLSQYKMDVTVIDTKDGSQSKLGGETVDMDCTLVSETVLLKMKKQEQKGEKSSNEERKM
NDSLEDMFDRTTHEEYESCLADSFSQAADEEEELSTATKKLHTHGDKQDKVKQKAFVEPY
FKGDERETSLQNFPHIEVVRKKEERRKLLGHTCKECEIYYADMPAEEREKKLASCSRHRF
RYIPPNTPENFWEVGFPSTQTCMERGYIKEDLDPCPRPKRRQPYNAIFSPKGKEQKT
NT seq 2694 nt NT seq  +upstreamnt  +downstreamnt
atgaacatctcgggaagcagctgtggaagccctaactctgcagatacatctagtgacttt
aaggacctttggacaaaactaaaagaatgtcatgatagagaagtacaaggtttacaagta
aaagtaaccaagctaaaacaggaacgaatcttagatgcacaaagactagaagaattcttc
accaaaaatcaacagctgagggaacagcagaaagtccttcatgaaaccattaaagtttta
gaagatcggttaagagcaggcttatgtgatcgctgtgcagtaactgaagaacatatgcgg
aaaaaacagcaagagtttgaaaatatccggcagcagaatcttaaacttattacagaactt
atgaatgaaaggaatactctacaggaagaaaataaaaagctttctgaacaactccagcag
aaaattgagaatgatcaacagcatcaagcagctgagcttgaatgtgaggaagacgttatt
ccagattcaccgataacagccttctcattttctggcgttaaccggctacgaagaaaggag
aacccccatgtccgatacatagaacaaacacatactaaattggagcactctgtgtgtgca
aatgaaatgagaaaagtttccaagtcttcaactcatccacaacataatcctaatgaaaat
gaaattctagtagctgacacttatgaccaaagtcaatctccaatggccaaagcacatgga
acaagcagctatacccctgataagtcatcttttaatttagctacagttgttgctgaaaca
cttggacttggtgttcaagaagaatctgaaactcaaggtcccatgagcccccttggtgat
gagctctaccactgtctggaaggaaatcacaagaaacagccttttgaggaatctacaaga
aatactgaagatagtttaagattttcagattctacttcaaagactcctcctcaagaagaa
ttacctactcgagtgtcatctcctgtatttggagctacctctagtatcaaaagtggttta
gatttgaatacaagtttgtccccttctcttttacagcctgggaaaaaaaaacatctgaaa
acactcccttttagcaacacttgtatatctagattagaaaaaactagatcaaaatctgaa
gatagtgcccttttcacacatcacagtcttgggtctgaagtgaacaagatcattatccag
tcatctaataaacagatacttataaataaaaatataagtgaatccctaggtgaacagaat
aggactgagtacggtaaagattctaacactgataaacatttggagcccctgaaatcattg
ggaggccgaacatccaaaaggaagaaaactgaggaagaaagtgaacatgaagtaagctgc
ccccaagcttcttttgataaagaaaatgctttcccttttccaatggataatcagttttcc
atgaatggagactgtgtgatggataaacctctggatctgtctgatcgattttcagctatt
cagcgtcaagagaaaagccaaggaagtgagacttctaaaaacaaatttaggcaagtgact
ctttatgaggctttgaagaccattccaaagggcttttcctcaagccgtaaggcctcagat
ggcaactgcacgttgcccaaagattccccaggggagccctgttcacaggaatgcatcatc
cttcagcccttgaataaatgctctccagacaataaaccatcattacaaataaaagaagaa
aatgctgtctttaaaattcctctacgtccacgtgaaagtttggagactgagaatgtttta
gatgacataaagagtgctggttctcatgagccaataaaaatacaaaccaggtcagaccat
ggaggatgtgaacttgcatcagttcttcagttaaatccatgtagaactggtaaaataaag
tctctacaaaacaaccaagatgtatcctttgaaaatatccagtggagtatagatccggga
gcagacctttctcagtataaaatggatgttactgtaatagatacaaaggatggcagtcag
tcaaaattaggaggagagacagtggacatggactgtacattggttagtgaaaccgttctc
ttaaaaatgaagaagcaagagcagaagggagaaaaaagttcaaatgaagaaagaaaaatg
aatgatagcttggaagatatgtttgatcggacaacacatgaagagtatgaatcctgtttg
gcagacagtttctcccaagcagcagatgaagaggaggaattgtctactgccacaaagaaa
ctacacactcatggtgataaacaagacaaagtcaagcagaaagcgtttgtggagccgtat
tttaaaggtgatgaaagagagactagcttgcaaaattttcctcatattgaggtggttcgg
aaaaaagaggagagaagaaaactgcttgggcacacgtgtaaggaatgtgaaatttattat
gcagatatgccagcagaagaaagagaaaagaaattggcttcctgctcaagacaccgattc
cgctacattccacccaacacaccagagaatttttgggaagttggttttccttccactcag
acttgtatggaaagaggttatattaaggaagatcttgatccttgtcctcgtccaaaaaga
cgtcagccttacaacgcaatattttctccaaaaggcaaggagcagaagacatag

DBGET integrated database retrieval system