KEGG   Homo sapiens (human): 5933Help
Entry
5933              CDS       T01001                                 

Gene name
RBL1, CP107, PRB1, p107
Definition
(RefSeq) RB transcriptional corepressor like 1
  KO
K04681  retinoblastoma-like protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04218  Cellular senescence
hsa04350  TGF-beta signaling pathway
hsa05165  Human papillomavirus infection
hsa05203  Viral carcinogenesis
Module
hsa_M00692  Cell cycle - G1/S transition
Network
N00361  HPV E7 to cell cycle G1/S
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    5933 (RBL1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    5933 (RBL1)
   04218 Cellular senescence
    5933 (RBL1)
 09160 Human Diseases
  09161 Cancers: Overview
   05203 Viral carcinogenesis
    5933 (RBL1)
  09172 Infectious diseases: Viral
   05165 Human papillomavirus infection
    5933 (RBL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    5933 (RBL1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain Rb
    5933 (RBL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RB_A RB_B DUF3452 Rb_C ATLF
Motif
Other DBs
NCBI-GeneID: 5933
NCBI-ProteinID: NP_002886
OMIM: 116957
HGNC: 9893
Ensembl: ENSG00000080839
Vega: OTTHUMG00000032406
Pharos: P28749(Tbio)
UniProt: P28749
Structure
PDB: 

Position
20q11.23
AA seq 1068 aa AA seqDB search
MFEDKPHAEGAAVVAAAGEALQALCQELNLDEGSAAEALDDFTAIRGNYSLEGEVTHWLA
CSLYVACRKSIIPTVGKGIMEGNCVSLTRILRSAKLSLIQFFSKMKKWMDMSNLPQEFRE
RIERLERNFEVSTVIFKKYEPIFLDIFQNPYEEPPKLPRSRKQRRIPCSVKDLFNFCWTL
FVYTKGNFRMIGDDLVNSYHLLLCCLDLIFANAIMCPNRQDLLNPSFKGLPSDFHTADFT
ASEEPPCIIAVLCELHDGLLVEAKGIKEHYFKPYISKLFDRKILKGECLLDLSSFTDNSK
AVNKEYEEYVLTVGDFDERIFLGADAEEEIGTPRKFTRDTPLGKLTAQANVEYNLQQHFE
KKRSFAPSTPLTGRRYLREKEAVITPVASATQSVSRLQSIVAGLKNAPSDQLINIFESCV
RNPVENIMKILKGIGETFCQHYTQSTDEQPGSHIDFAVNRLKLAEILYYKILETVMVQET
RRLHGMDMSVLLEQDIFHRSLMACCLEIVLFAYSSPRTFPWIIEVLNLQPFYFYKVIEVV
IRSEEGLSRDMVKHLNSIEEQILESLAWSHDSALWEALQVSANKVPTCEEVIFPNNFETG
NGGNVQGHLPLMPMSPLMHPRVKEVRTDSGSLRRDMQPLSPISVHERYSSPTAGSAKRRL
FGEDPPKEMLMDKIITEGTKLKIAPSSSITAENVSILPGQTLLTMATAPVTGTTGHKVTI
PLHGVANDAGEITLIPLSMNTNQESKVKSPVSLTAHSLIGASPKQTNLTKAQEVHSTGIN
RPKRTGSLALFYRKVYHLASVRLRDLCLKLDVSNELRRKIWTCFEFTLVHCPDLMKDRHL
DQLLLCAFYIMAKVTKEERTFQEIMKSYRNQPQANSHVYRSVLLKSIPREVVAYNKNIND
DFEMIDCDLEDATKTPDCSSGPVKEERGDLIKFYNTIYVGRVKSFALKYDLANQDHMMDA
PPLSPFPHIKQQPGSPRRISQQHSIYISPHKNGSGLTPRSALLYKFNGSPSKSLKDINNM
IRQGEQRTKKRVIAIDSDAESPAKRVCQENDDVLLKRLQDVVSERANH
NT seq 3207 nt NT seq  +upstreamnt  +downstreamnt
atgttcgaggacaagccccacgctgagggggcggcggtggtcgccgcagccggggaggcg
ctacaggccctgtgccaggagctgaacctggacgaggggagcgcggccgaagccctggac
gactttactgccatccgaggcaactacagcctagagggagaagttacacactggttggca
tgttcattatatgttgcatgccgcaaaagcattattcccacggttggaaagggtatcatg
gaaggcaactgtgtttcacttaccagaatactacgttcagctaaattaagtttaatacaa
ttttttagtaaaatgaagaaatggatggacatgtcaaatctaccacaagaatttcgtgaa
cgtatagaaaggctagagagaaattttgaggtgtctactgtaatattcaaaaaatatgag
ccaatttttttagatatatttcaaaatccatatgaagaaccaccaaagttaccacgaagc
cggaagcagaggaggattccttgcagtgttaaggatctgtttaatttctgttggacactt
tttgtttatactaagggtaattttcggatgattggggatgacttagtaaactcttatcat
ttacttctatgctgcttggatctgatttttgccaatgcgattatgtgcccaaatagacaa
gacttgctaaatccatcatttaaaggtttaccatctgattttcatactgctgactttacg
gcttctgaagagccaccctgcatcattgctgtactgtgtgaactgcatgatggacttctc
gtagaagcaaaaggaataaaggagcactactttaagccatatatttcaaaactctttgac
aggaagatattaaaaggagaatgcctcctggacctttcaagttttactgataatagcaaa
gcagtgaataaggagtatgaagagtatgttctaactgttggtgattttgatgagaggatc
tttttgggagcagacgcagaagaggaaattggaacacctcgaaagttcactcgtgacacc
ccattagggaaactgacagcacaggctaatgtggagtataaccttcaacagcactttgaa
aaaaaaaggtcatttgcaccttctaccccactgaccggacggagatatttacgagaaaaa
gaagcagtcattactcctgttgcatcagccacccaaagtgtgagccggttacagagtatt
gtggctggtctgaaaaatgcaccaagtgaccaacttataaatatttttgaatcttgtgtg
cgtaatcctgtggaaaacattatgaaaatactaaaaggaataggagagactttctgtcaa
cactatactcaatcaacagatgaacagccaggatctcacatagactttgctgtaaacaga
ctaaagctggcagaaattttgtattataaaatactagagactgtaatggttcaggaaaca
cgaagacttcatggaatggacatgtcagttcttttagagcaagatatatttcatcgttcc
ttgatggcttgttgtttggaaattgtgctctttgcctatagctcacctcgtacttttcct
tggattattgaagttctcaacttgcaaccattttacttttataaggttattgaggtggtg
atccgctcagaagaggggctctcaagggacatggtgaaacacctaaacagcattgaagaa
cagattttggagagtttagcatggagtcacgattctgcactgtgggaggctctccaggtt
tctgcaaacaaagttcctacctgtgaagaagttatattcccaaataactttgaaacagga
aatggaggaaatgtgcagggacatcttcccctgatgccaatgtctcctctaatgcaccca
agagtcaaggaagttcgaactgacagtgggagtcttcgaagagatatgcaaccattgtct
ccaatttctgtccatgaacgctacagttctcctaccgcagggagtgctaagagaagactc
tttggagaggaccccccaaaggaaatgcttatggacaagatcataacagaaggaacaaaa
ttgaaaatcgctccttcttcaagcattactgctgaaaatgtatcaattttacctggtcaa
actcttctaacaatggccacagccccagtaacaggaacaacaggacataaagttacaatt
ccattacatggtgtcgcaaatgatgctggagagatcacactgatacctctttccatgaat
acaaatcaggagtccaaagtcaagagtcctgtatcacttactgctcattcattaattggt
gcttctccaaaacagaccaatctgactaaagcacaagaggtacattcaactggaataaac
aggccaaagagaactgggtccttagcactattttacagaaaggtctatcatttggcaagt
gtacgcttacgtgatctatgtctaaaactggatgtttcaaatgagttacgaaggaagata
tggacgtgttttgaattcactttagttcactgtcctgatctaatgaaagacaggcatttg
gatcagctcctcctttgtgccttttatatcatggcaaaggtaacaaaagaagaaagaact
tttcaagaaattatgaaaagttataggaatcagccccaagctaatagtcacgtatataga
agtgttctgctgaaaagtattccaagagaagttgtggcatataataaaaatataaatgat
gactttgaaatgatagattgtgacttagaagatgctacaaaaacacctgactgttccagt
ggaccagtgaaagaggaaagaggtgatcttataaaattttacaatacaatatatgtagga
agagtgaagtcatttgcactgaaatacgacttggcgaatcaggaccatatgatggatgct
ccaccactctctccttttccacatattaaacaacagccaggctcaccacgccgcatttcc
cagcagcactccatttatatttccccgcacaagaatgggtcaggccttacaccaagaagc
gctctgctgtacaagttcaatggcagcccttctaagagtttgaaagatatcaacaacatg
ataaggcaaggtgagcagagaaccaagaagcgagtaatagccatcgatagtgatgcagaa
tcccctgccaaacgcgtctgtcaagaaaatgatgacgttttactgaaacgactacaggat
gttgtcagtgaaagagcaaatcattaa

DBGET integrated database retrieval system