KEGG   Homo sapiens (human): 59340Help
Entry
59340             CDS       T01001                                 

Gene name
HRH4, AXOR35, BG26, GPCR105, GPRv53, H4, H4R, HH4R
Definition
(RefSeq) histamine receptor H4
  KO
K04152  histamine receptor H4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Drug target
Histamine: D08040
Toreforant (DG01866): D10735 D10736
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    59340 (HRH4)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Histamine [OT]
    59340 (HRH4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 MPS-4
Motif
Other DBs
NCBI-GeneID: 59340
NCBI-ProteinID: NP_067637
OMIM: 606792
HGNC: 17383
Ensembl: ENSG00000134489
Vega: OTTHUMG00000131945
Pharos: Q9H3N8(Tchem)
UniProt: Q9H3N8
Position
18q11.2
AA seq 390 aa AA seqDB search
MPDTNSTINLSLSTRVTLAFFMSLVAFAIMLGNALVILAFVVDKNLRHRSSYFFLNLAIS
DFFVGVISIPLYIPHTLFEWDFGKEICVFWLTTDYLLCTASVYNIVLISYDRYLSVSNAV
SYRTQHTGVLKIVTLMVAVWVLAFLVNGPMILVSESWKDEGSECEPGFFSEWYILAITSF
LEFVIPVILVAYFNMNIYWSLWKRDHLSRCQSHPGLTAVSSNICGHSFRGRLSSRRSLSA
STEVPASFHSERQRRKSSLMFSSRTKMNSNTIASKMGSFSQSDSVALHQREHVELLRARR
LAKSLAILLGVFAVCWAPYSLFTIVLSFYSSATGPKSVWYRIAFWLQWFNSFVNPLLYPL
CHKRFQKAFLKIFCIKKQPLPSQHSRSVSS
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgccagatactaatagcacaatcaatttatcactaagcactcgtgttactttagcattt
tttatgtccttagtagcttttgctataatgctaggaaatgctttggtcattttagctttt
gtggtggacaaaaaccttagacatcgaagtagttatttttttcttaacttggccatctct
gacttctttgtgggtgtgatctccattcctttgtacatccctcacacgctgttcgaatgg
gattttggaaaggaaatctgtgtattttggctcactactgactatctgttatgtacagca
tctgtatataacattgtcctcatcagctatgatcgatacctgtcagtctcaaatgctgtg
tcttatagaactcaacatactggggtcttgaagattgttactctgatggtggccgtttgg
gtgctggccttcttagtgaatgggccaatgattctagtttcagagtcttggaaggatgaa
ggtagtgaatgtgaacctggatttttttcggaatggtacatccttgccatcacatcattc
ttggaattcgtgatcccagtcatcttagtcgcttatttcaacatgaatatttattggagc
ctgtggaagcgtgatcatctcagtaggtgccaaagccatcctggactgactgctgtctct
tccaacatctgtggacactcattcagaggtagactatcttcaaggagatctctttctgca
tcgacagaagttcctgcatcctttcattcagagagacagaggagaaagagtagtctcatg
ttttcctcaagaaccaagatgaatagcaatacaattgcttccaaaatgggttccttctcc
caatcagattctgtagctcttcaccaaagggaacatgttgaactgcttagagccaggaga
ttagccaagtcactggccattctcttaggggtttttgctgtttgctgggctccatattct
ctgttcacaattgtcctttcattttattcctcagcaacaggtcctaaatcagtttggtat
agaattgcattttggcttcagtggttcaattcctttgtcaatcctcttttgtatccattg
tgtcacaagcgctttcaaaaggctttcttgaaaatattttgtataaaaaagcaacctcta
ccatcacaacacagtcggtcagtatcttcttaa

DBGET integrated database retrieval system