KEGG   Homo sapiens (human): 59350Help
Entry
59350             CDS       T01001                                 

Gene name
RXFP1, LGR7, RXFPR1
Definition
(RefSeq) relaxin family peptide receptor 1
  KO
K04306  relaxin family peptide receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04926  Relaxin signaling pathway
Drug target
Serelaxin: D10488
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    59350 (RXFP1)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    59350 (RXFP1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    59350 (RXFP1)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Relaxin
    59350 (RXFP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 7tm_1 LRR_5 LRR_4 LRR_9 Ldl_recept_a LRRNT
Motif
Other DBs
NCBI-GeneID: 59350
NCBI-ProteinID: NP_067647
OMIM: 606654
HGNC: 19718
Ensembl: ENSG00000171509
Vega: OTTHUMG00000149973
Pharos: Q9HBX9(Tbio)
UniProt: Q9HBX9
Structure
PDB: 

Position
4q32.1
AA seq 757 aa AA seqDB search
MTSGSVFFYILIFGKYFSHGGGQDVKCSLGYFPCGNITKCLPQLLHCNGVDDCGNQADED
NCGDNNGWSLQFDKYFASYYKMTSQYPFEAETPECLVGSVPVQCLCQGLELDCDETNLRA
VPSVSSNVTAMSLQWNLIRKLPPDCFKNYHDLQKLYLQNNKITSISIYAFRGLNSLTKLY
LSHNRITFLKPGVFEDLHRLEWLIIEDNHLSRISPPTFYGLNSLILLVLMNNVLTRLPDK
PLCQHMPRLHWLDLEGNHIHNLRNLTFISCSNLTVLVMRKNKINHLNENTFAPLQKLDEL
DLGSNKIENLPPLIFKDLKELSQLNLSYNPIQKIQANQFDYLVKLKSLSLEGIEISNIQQ
RMFRPLMNLSHIYFKKFQYCGYAPHVRSCKPNTDGISSLENLLASIIQRVFVWVVSAVTC
FGNIFVICMRPYIRSENKLYAMSIISLCCADCLMGIYLFVIGGFDLKFRGEYNKHAQLWM
ESTHCQLVGSLAILSTEVSVLLLTFLTLEKYICIVYPFRCVRPGKCRTITVLILIWITGF
IVAFIPLSNKEFFKNYYGTNGVCFPLHSEDTESIGAQIYSVAIFLGINLAAFIIIVFSYG
SMFYSVHQSAITATEIRNQVKKEMILAKRFFFIVFTDALCWIPIFVVKFLSLLQVEIPGT
ITSWVVIFILPINSALNPILYTLTTRPFKEMIHRFWYNYRQRKSMDSKGQKTYAPSFIWV
EMWPLQEMPPELMKPDLFTYPCEMSLISQSTRLNSYS
NT seq 2274 nt NT seq  +upstreamnt  +downstreamnt
atgacatctggttctgtcttcttctacatcttaatttttggaaaatatttttctcatggg
ggtggacaggatgtcaagtgctcccttggctatttcccctgtgggaacatcacaaagtgc
ttgcctcagctcctgcactgtaacggtgtggacgactgcgggaatcaggccgatgaggac
aactgtggagacaacaatggatggtctctgcaatttgacaaatattttgccagttactac
aaaatgacttcccaatatccttttgaggcagaaacacctgaatgtttggtcggttctgtg
ccagtgcaatgtctttgccaaggtctggagcttgactgtgatgaaaccaatttacgagct
gttccatcggtttcttcaaatgtgactgcaatgtcacttcagtggaacttaataagaaag
cttcctcctgattgcttcaagaattatcatgatcttcagaagctgtacctgcaaaacaat
aagattacatccatctccatctatgctttcagaggactgaatagccttactaaactgtat
ctcagtcataacagaataaccttcctgaagccgggtgtttttgaagatcttcacagacta
gaatggctgataattgaagataatcacctcagtcgaatttccccaccaacattttatgga
ctaaattctcttattctcttagtcctgatgaataacgtcctcacccgtttacctgataaa
cctctctgtcaacacatgccaagactacattggctggaccttgaaggcaaccatatccat
aatttaagaaatttgacttttatttcctgcagtaatttaactgttttagtgatgaggaaa
aacaaaattaatcacttaaatgaaaatacttttgcacctctccagaaactggatgaattg
gatttaggaagtaataagattgaaaatcttccaccgcttatattcaaggacctgaaggag
ctgtcacaattgaatctttcctataatccaatccagaaaattcaagcaaaccaatttgat
tatcttgtcaaactcaagtctctcagcctagaagggattgaaatttcaaatatccaacaa
aggatgtttagacctcttatgaatctctctcacatatattttaagaaattccagtactgt
gggtatgcaccacatgttcgcagctgtaaaccaaacactgatggaatttcatctctagag
aatctcttggcaagcattattcagagagtatttgtctgggttgtatctgcagttacctgc
tttggaaacatttttgtcatttgcatgcgaccttatatcaggtctgagaacaagctgtat
gccatgtcaatcatttctctctgctgtgccgactgcttaatgggaatatatttattcgtg
atcggaggctttgacctaaagtttcgtggagaatacaataagcatgcgcagctgtggatg
gagagtactcattgtcagcttgtaggatctttggccattctgtccacagaagtatcagtt
ttactgttaacatttctgacattggaaaaatacatctgcattgtctatccttttagatgt
gtgagacctggaaaatgcagaacaattacagttctgattctcatttggattactggtttt
atagtggctttcattccattgagcaataaggaatttttcaaaaactactatggcaccaat
ggagtatgcttccctcttcattcagaagatacagaaagtattggagcccagatttattca
gtggcaatttttcttggtattaatttggccgcatttatcatcatagttttttcctatgga
agcatgttttatagtgttcatcaaagtgccataacagcaactgaaatacggaatcaagtt
aaaaaagagatgatccttgccaaacgttttttctttatagtatttactgatgcattatgc
tggatacccatttttgtagtgaaatttctttcactgcttcaggtagaaataccaggtacc
ataacctcttgggtagtgatttttattctgcccattaacagtgctttgaacccaattctc
tatactctgaccacaagaccatttaaagaaatgattcatcggttttggtataactacaga
caaagaaaatctatggacagcaaaggtcagaaaacatatgctccatcattcatctgggtg
gaaatgtggccactgcaggagatgccacctgagttaatgaagccggaccttttcacatac
ccctgtgaaatgtcactgatttctcaatcaacgagactcaattcctattcatga

DBGET integrated database retrieval system