KEGG   Homo sapiens (human): 5936
Entry
5936              CDS       T01001                                 
Symbol
RBM4, LARK, RBM4A, ZCCHC21, ZCRB3A
Name
(RefSeq) RNA binding motif protein 4
  KO
K13187  RNA-binding protein 4
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    5936 (RBM4)
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA binding proteins (RBPs)
    5936 (RBM4)
SSDB
Motif
Pfam: RRM_1 zf-CCHC RRM_5 RRM_7 RRM_occluded zf-CCHC_3 zf-CCHC_5 zf-CCHC_2 CompInhib_SCIN DUF3275
Other DBs
NCBI-GeneID: 5936
NCBI-ProteinID: NP_002887
OMIM: 602571
HGNC: 9901
Ensembl: ENSG00000173933
Pharos: Q9BWF3(Tbio)
UniProt: Q9BWF3
Structure
Position
11:66638703..66668380
AA seq 364 aa
MVKLFIGNLPREATEQEIRSLFEQYGKVLECDIIKNYGFVHIEDKTAAEDAIRNLHHYKL
HGVNINVEASKNKSKTSTKLHVGNISPTCTNKELRAKFEEYGPVIECDIVKDYAFVHMER
AEDAVEAIRGLDNTEFQGKRMHVQLSTSRLRTAPGMGDQSGCYRCGKEGHWSKECPIDRS
GRVADLTEQYNEQYGAVRTPYTMSYGDSLYYNNAYGALDAYYKRCRAARSYEAVAAAAAS
VYNYAEQTLSQLPQVQNTAMASHLTSTSLDPYDRHLLPTSGAAATAAAAAAAAAAVTAAS
TSYYGRDRSPLRRATAPVPTVGEGYGYGHESELSQASAAARNSLYDMARYEREQYADRAR
YSAF
NT seq 1095 nt   +upstreamnt  +downstreamnt
atggtgaagctgttcatcggaaacctgccccgggaggctacagagcaggagattcgctca
ctcttcgagcagtatgggaaggtgctggaatgtgacatcattaagaattacggctttgtg
cacatagaagacaagacggcagctgaggatgccatacgcaacctgcaccattacaagctt
catggggtgaacatcaacgtggaagccagcaagaataagagcaaaacctcaacaaagttg
catgtgggcaacatcagtcccacctgcaccaataaggagcttcgagccaagtttgaggag
tatggtccggtcatcgaatgtgacatcgtgaaagattatgccttcgtacacatggagcgg
gcagaggatgcagtggaggccatcaggggccttgataacacagagtttcaaggcaaacga
atgcacgtgcagttgtccaccagccggcttaggactgcgcccgggatgggagaccagagc
ggctgctatcggtgcgggaaagaggggcactggtccaaagagtgtccgatagatcgttca
ggccgcgtggcagacttgaccgagcaatataatgagcaatacggagcagtgcgtacgcct
tacaccatgagctatggggattcattgtattacaacaacgcgtacggagcgctcgatgcc
tactacaagcgctgccgtgctgcccggtcctatgaggcagtggcagctgcagctgcctcc
gtgtataattacgcagagcagaccctgtcccagctgccacaagtccagaatacagccatg
gccagtcacctcacctccacctctctcgatccctacgatagacacctgttgccgacctca
ggagctgctgccacagctgctgctgcagcagcagccgctgctgctgttactgcagcttcc
acttcatattacgggcgggatcggagccccctgcgtcgcgctacagccccagtccccact
gttggagagggctacggttacgggcatgagagtgagttgtcccaagcttcagcagccgcg
cggaattctctgtacgacatggcccggtatgagcgggagcagtatgccgatcgggcgcgg
tactcagccttttaa

DBGET integrated database retrieval system