KEGG   Homo sapiens (human): 5947
Entry
5947              CDS       T01001                                 

Symbol
RBP1, CRABP-I, CRBP, CRBP1, CRBPI, RBPC
Name
(RefSeq) retinol binding protein 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Lipocalin Lipocalin_7
Other DBs
NCBI-GeneID: 5947
NCBI-ProteinID: NP_001124465
OMIM: 180260
HGNC: 9919
Ensembl: ENSG00000114115
Vega: OTTHUMG00000155751
Pharos: P09455(Tbio)
UniProt: P09455
Structure
PDB: 

Position
3q23
AA seq 153 aa
MDPPAGFVRAGNPAVAAPQSPLSPEGAHFRAAHHPRSTGSRCPGSLQPSRPLVANWLQSL
PEMPVDFTGYWKMLVNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTF
RNYIMDFQVGKEFEEDLTGIDDRKCMSETGFSS
NT seq 462 nt   +upstreamnt  +downstreamnt
atggatcctcccgcaggctttgtgcgcgctgggaatccagctgtcgccgccccgcagagc
cccctgtccccggagggcgctcatttccgggccgcccaccacccgcgtagcaccggcagc
cgctgtcccggcagtctccagccgtcccgcccgcttgtggccaactggctccagtcactc
cccgaaatgccagtcgacttcactgggtactggaagatgttggtcaacgagaatttcgag
gagtacctgcgcgccctcgacgtcaatgtggccttgcgcaaaatcgccaacttgctgaag
ccagacaaagagatcgtgcaggacggtgaccatatgatcatccgcacgctgagcactttt
aggaactacatcatggacttccaggttgggaaggagtttgaggaggatctgacaggcata
gatgaccgcaagtgcatgagtgaaactggcttttcctcttga

DBGET integrated database retrieval system