KEGG   Homo sapiens (human): 5948
Entry
5948              CDS       T01001                                 

Symbol
RBP2, CRABP-II, CRBP2, CRBPII, RBPC2
Name
(RefSeq) retinol binding protein 2
  KO
K14622  retinol binding protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04977  Vitamin digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04977 Vitamin digestion and absorption
    5948 (RBP2)
SSDB
Motif
Pfam: Lipocalin Lipocalin_7
Other DBs
NCBI-GeneID: 5948
NCBI-ProteinID: NP_004155
OMIM: 180280
HGNC: 9920
Ensembl: ENSG00000114113
Vega: OTTHUMG00000159956
Pharos: P50120(Tbio)
UniProt: P50120
Structure
PDB: 

Position
3q23
AA seq 134 aa
MTRDQNGTWEMESNENFEGYMKALDIDFATRKIAVRLTQTKVIDQDGDNFKTKTTSTFRN
YDVDFTVGVEFDEYTKSLDNRHVKALVTWEGDVLVCVQKGEKENRGWKQWIEGDKLYLEL
TCGDQVCRQVFKKK
NT seq 405 nt   +upstreamnt  +downstreamnt
atgacaagggaccagaatggaacctgggagatggagagtaatgaaaactttgagggctac
atgaaggccctggatattgattttgccacccgcaagattgcagtacgtctcactcagacg
aaggttattgatcaagatggtgataacttcaagacaaaaaccactagcacattccgcaac
tatgatgtggatttcactgttggagtagagtttgacgagtacacaaagagcctggataac
cggcatgttaaggcactggtcacctgggaaggtgatgtccttgtgtgtgtgcaaaagggg
gagaaggagaaccgcggctggaagcagtggattgagggggacaagctgtacctggagctg
acctgtggtgaccaggtgtgccgtcaagtgttcaaaaagaaatga

DBGET integrated database retrieval system