KEGG   Homo sapiens (human): 594855Help
Entry
594855            CDS       T01001                                 

Gene name
CPLX3, CPX-III, CPXIII, Nbla11589
Definition
(RefSeq) complexin 3
  KO
K15295  complexin-3/4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Nervous system
   04721 Synaptic vesicle cycle
    594855 (CPLX3)
Membrane trafficking [BR:hsa04131]
 SNARE
  SNARE associated proteins
   Syntaxin-binding proteins
    594855 (CPLX3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Synaphin Complex1_LYR
Motif
Other DBs
NCBI-GeneID: 594855
NCBI-ProteinID: NP_001025176
OMIM: 609585
HGNC: 27652
Ensembl: ENSG00000213578
Vega: OTTHUMG00000142816
Pharos: Q8WVH0(Tbio)
UniProt: Q8WVH0
Position
15q24.1
AA seq 158 aa AA seqDB search
MAFMVKTMVGGQLKNLTGSLGGGEDKGDGDKSAAEAQGMSREEYEEYQKQLVEEKMERDA
QFTQRKAERATLRSHFRDKYRLPKNETDESQIQMAGGDVELPRELAKMIEEDTEEEEEKA
SVLGQLASLPGLNLGSLKDKAQATLGDLKQSAEKCHVM
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcatggtgaagaccatggtgggcggccagctgaagaacctcactgggagcctg
ggaggcggcgaggataagggagatggggacaagtcggcagccgaagctcagggcatgagc
cgggaggagtacgaggagtatcagaagcaactcgtggaagagaagatggagcgggatgca
cagttcacacagaggaaggcagagcgggccacactgcggagccacttccgagacaaatac
cggctacccaagaacgagacagatgagagccagatccagatggcaggtggagacgtggag
ctgccccgggagctggccaagatgatcgaggaggacacagaggaggaggaggagaaggcc
tcagtccttgggcagctggccagccttcctggcttgaacctgggctcactcaaggacaag
gcccaggccacactgggggatctcaagcaatcagctgagaagtgtcacgtcatgtga

DBGET integrated database retrieval system