KEGG   Homo sapiens (human): 5950
Entry
5950              CDS       T01001                                 

Symbol
RBP4, MCOPCB10, RDCCAS
Name
(RefSeq) retinol binding protein 4
  KO
K18271  retinol-binding protein 4
Organism
hsa  Homo sapiens (human)
Disease
H01027  Microphthalmia
H02291  Retinal dystrophy, iris coloboma, and comedogenic acne syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5950 (RBP4)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   5950 (RBP4)
SSDB
Motif
Pfam: Lipocalin Lipocalin_2 Triabin PH_19
Other DBs
NCBI-GeneID: 5950
NCBI-ProteinID: NP_001310446
OMIM: 180250
HGNC: 9922
Ensembl: ENSG00000138207
Vega: OTTHUMG00000018773
Pharos: P02753(Tchem)
UniProt: P02753
Structure
PDB: 

Position
10q23.33
AA seq 201 aa
MKWVWALLLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIV
AEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGND
DHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLA
RQYRLIVHNGYCDGRSERNLL
NT seq 606 nt   +upstreamnt  +downstreamnt
atgaagtgggtgtgggcgctcttgctgttggcggcgctgggcagcggccgcgcggagcgc
gactgccgagtgagcagcttccgagtcaaggagaacttcgacaaggctcgcttctctggg
acctggtacgccatggccaagaaggaccccgagggcctctttctgcaggacaacatcgtc
gcggagttctccgtggacgagaccggccagatgagcgccacagccaagggccgagtccgt
cttttgaataactgggacgtgtgcgcagacatggtgggcaccttcacagacaccgaggac
cctgccaagttcaagatgaagtactggggcgtagcctcctttctccagaaaggaaatgat
gaccactggatcgtcgacacagactacgacacgtatgccgtgcagtactcctgccgcctc
ctgaacctcgatggcacctgtgctgacagctactccttcgtgttttcccgggaccccaac
ggcctgcccccagaagcgcagaagattgtaaggcagcggcaggaggagctgtgcctggcc
aggcagtacaggctgatcgtccacaacggttactgcgatggcagatcagaaagaaacctt
ttgtag

DBGET integrated database retrieval system