KEGG   Homo sapiens (human): 5957
Entry
5957              CDS       T01001                                 

Gene name
RCVRN, RCV1
Definition
(RefSeq) recoverin
  KO
K13764  recoverin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    5957 (RCVRN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    5957 (RCVRN)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   5957 (RCVRN)
SSDB
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_4 SPARC_Ca_bdg FPL
Other DBs
NCBI-GeneID: 5957
NCBI-ProteinID: NP_002894
OMIM: 179618
HGNC: 9937
Ensembl: ENSG00000109047
Vega: OTTHUMG00000130268
Pharos: P35243(Tbio)
UniProt: P35243
Structure
PDB: 
2D8N

Position
17p13.1
AA seq 200 aa
MGNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDT
DPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKN
EVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANK
EILRLIQFEPQKVKEKMKNA
NT seq 603 nt   +upstreamnt  +downstreamnt
atggggaacagcaaaagtggggccctgtccaaggagatcctggaggagctgcagctgaac
accaagttctcggaggaggagctgtgctcctggtaccagtccttcctgaaggactgtccc
accggccgcatcacccagcagcagttccagagcatctacgccaagttcttccccgacacc
gaccccaaggcctacgcccagcatgtgttccgcagcttcgattccaacctcgacggcacc
ctggacttcaaggagtacgtcatcgccctgcacatgaccaccgcgggcaagaccaaccag
aagctggagtgggccttctccctctacgacgtggacggtaacgggaccatcagcaagaat
gaagtgctggagatcgtcatggctattttcaaaatgatcactcccgaggacgtgaagctc
cttccagacgatgaaaacacgccggaaaagcgagccgagaagatctggaagtactttgga
aagaatgatgatgataaacttacagagaaagaattcattgaggggacactggccaataag
gaaattctgcgactgatccagtttgagcctcaaaaagtgaaggaaaagatgaagaacgcc
tga

DBGET integrated database retrieval system