KEGG   Homo sapiens (human): 596Help
Entry
596               CDS       T01001                                 

Gene name
BCL2, Bcl-2, PPP1R50
Definition
(RefSeq) BCL2, apoptosis regulator
  KO
K02161  apoptosis regulator Bcl-2
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa01522  Endocrine resistance
hsa01524  Platinum drug resistance
hsa04064  NF-kappa B signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04115  p53 signaling pathway
hsa04140  Autophagy - animal
hsa04141  Protein processing in endoplasmic reticulum
hsa04151  PI3K-Akt signaling pathway
hsa04210  Apoptosis
hsa04215  Apoptosis - multiple species
hsa04217  Necroptosis
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04340  Hedgehog signaling pathway
hsa04510  Focal adhesion
hsa04621  NOD-like receptor signaling pathway
hsa04630  Jak-STAT signaling pathway
hsa04722  Neurotrophin signaling pathway
hsa04725  Cholinergic synapse
hsa04915  Estrogen signaling pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05014  Amyotrophic lateral sclerosis (ALS)
hsa05145  Toxoplasmosis
hsa05152  Tuberculosis
hsa05161  Hepatitis B
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05206  MicroRNAs in cancer
hsa05210  Colorectal cancer
hsa05215  Prostate cancer
hsa05222  Small cell lung cancer
hsa05226  Gastric cancer
hsa05418  Fluid shear stress and atherosclerosis
Network
N00098  Intrinsic apoptotic pathway
N00100  BCL2-overexpression to intrinsic apoptotic pathway
N00286  Nuclear-initiated estrogen signaling pathway
N00451  HIV Tat to intrinsic apoptotic pathway
N00452  HIV Nef to intrinsic apoptotic pathway
N00453  HIV Vpr to intrinsic apoptotic pathway
Disease
H00005  Chronic lymphocytic leukemia (CLL)
H00013  Small cell lung cancer
H00028  Choriocarcinoma
H00030  Cervical cancer
H00041  Kaposi sarcoma
H00054  Nasopharyngeal cancer
H01613  Follicular lymphoma
Drug target
Obatoclax mesylate: D08954
Oblimersen (DG00728): D05216 D08290
Venetoclax: D10679
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    596 (BCL2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    596 (BCL2)
   04630 Jak-STAT signaling pathway
    596 (BCL2)
   04064 NF-kappa B signaling pathway
    596 (BCL2)
   04066 HIF-1 signaling pathway
    596 (BCL2)
   04071 Sphingolipid signaling pathway
    596 (BCL2)
   04151 PI3K-Akt signaling pathway
    596 (BCL2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    596 (BCL2)
  09143 Cell growth and death
   04210 Apoptosis
    596 (BCL2)
   04215 Apoptosis - multiple species
    596 (BCL2)
   04217 Necroptosis
    596 (BCL2)
   04115 p53 signaling pathway
    596 (BCL2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    596 (BCL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    596 (BCL2)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    596 (BCL2)
   04928 Parathyroid hormone synthesis, secretion and action
    596 (BCL2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    596 (BCL2)
  09156 Nervous system
   04725 Cholinergic synapse
    596 (BCL2)
   04722 Neurotrophin signaling pathway
    596 (BCL2)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    596 (BCL2)
   05206 MicroRNAs in cancer
    596 (BCL2)
  09162 Cancers: Specific types
   05210 Colorectal cancer
    596 (BCL2)
   05226 Gastric cancer
    596 (BCL2)
   05215 Prostate cancer
    596 (BCL2)
   05222 Small cell lung cancer
    596 (BCL2)
  09164 Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    596 (BCL2)
  09166 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    596 (BCL2)
  09167 Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    596 (BCL2)
  09171 Infectious diseases: Bacterial
   05152 Tuberculosis
    596 (BCL2)
  09172 Infectious diseases: Viral
   05170 Human immunodeficiency virus 1 infection
    596 (BCL2)
   05161 Hepatitis B
    596 (BCL2)
   05169 Epstein-Barr virus infection
    596 (BCL2)
  09174 Infectious diseases: Parasitic
   05145 Toxoplasmosis
    596 (BCL2)
  09176 Drug resistance: Antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    596 (BCL2)
   01524 Platinum drug resistance
    596 (BCL2)
   01522 Endocrine resistance
    596 (BCL2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    596 (BCL2)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     596 (BCL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Motif
Other DBs
NCBI-GeneID: 596
NCBI-ProteinID: NP_000624
OMIM: 151430
HGNC: 990
Ensembl: ENSG00000171791
Vega: OTTHUMG00000132791
Pharos: P10415(Tclin)
UniProt: P10415 A0A024R2B3
Structure
PDB: 

Position
18q21.33
AA seq 239 aa AA seqDB search
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggcgcacgctgggagaacagggtacgataaccgggagatagtgatgaagtacatccat
tataagctgtcgcagaggggctacgagtgggatgcgggagatgtgggcgccgcgcccccg
ggggccgcccccgcaccgggcatcttctcctcccagcccgggcacacgccccatccagcc
gcatcccgggacccggtcgccaggacctcgccgctgcagaccccggctgcccccggcgcc
gccgcggggcctgcgctcagcccggtgccacctgtggtccacctgaccctccgccaggcc
ggcgacgacttctcccgccgctaccgccgcgacttcgccgagatgtccagccagctgcac
ctgacgcccttcaccgcgcggggacgctttgccacggtggtggaggagctcttcagggac
ggggtgaactgggggaggattgtggccttctttgagttcggtggggtcatgtgtgtggag
agcgtcaaccgggagatgtcgcccctggtggacaacatcgccctgtggatgactgagtac
ctgaaccggcacctgcacacctggatccaggataacggaggctgggatgcctttgtggaa
ctgtacggccccagcatgcggcctctgtttgatttctcctggctgtctctgaagactctg
ctcagtttggccctggtgggagcttgcatcaccctgggtgcctatctgggccacaagtga

DBGET integrated database retrieval system